BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30238 (672 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 23 3.0 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 4.0 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 22 4.0 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 21 9.2 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 21 9.2 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 22.6 bits (46), Expect = 3.0 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = -3 Query: 553 RLRALADYEHVV-QPRAKV-CPVESLMCTMSKEPGCLSRDTMVPTRPKLR 410 RL A ++ V + RA + C V+S +K GC S ++ V T LR Sbjct: 75 RLAVEAGFDWVYYESRAHIHCSVKSESSQAAKYGGCFSGESTVLTSTGLR 124 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 22.2 bits (45), Expect = 4.0 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -3 Query: 400 IIHKFPDSNLMKSIIFVVAMSNWMESL 320 II +F L + VV +SNW E L Sbjct: 239 IIARFNIERLCNGLKRVVKLSNWREPL 265 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 22.2 bits (45), Expect = 4.0 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 571 RQGHPPHHRRG 603 RQG PPHH G Sbjct: 57 RQGIPPHHYGG 67 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 21.0 bits (42), Expect = 9.2 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +2 Query: 305 PTYQSQRFHPVRHRNYEDYGLHQ 373 P Q Q ++ H N E+Y HQ Sbjct: 353 PNPQQQYYYNKNHPNSENYINHQ 375 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 21.0 bits (42), Expect = 9.2 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +2 Query: 305 PTYQSQRFHPVRHRNYEDYGLHQ 373 P Q Q ++ H N E+Y HQ Sbjct: 301 PNPQQQYYYNKNHPNSENYINHQ 323 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,204 Number of Sequences: 336 Number of extensions: 3800 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17489640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -