BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30237 (647 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 21 6.6 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 8.7 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 21 8.7 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 21.4 bits (43), Expect = 6.6 Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +3 Query: 444 YVRLIII-IKYVLYVSYLFYFCSSFVRSFGHSLT 542 Y+ L +I + YVL + Y Y+ F H T Sbjct: 101 YLLLFVINVLYVLTLCYAVYYWRQQYEDFWHRYT 134 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 101 GRAVVLQLEEHVEGH 57 G VV+ +E H+EG+ Sbjct: 181 GDKVVIDVENHIEGN 195 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 101 GRAVVLQLEEHVEGH 57 G VV+ +E H+EG+ Sbjct: 181 GDKVVIDVENHIEGN 195 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,529 Number of Sequences: 336 Number of extensions: 1981 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -