BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30234 (718 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 23 3.8 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 5.0 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 21 8.8 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 8.8 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 21 8.8 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.6 bits (46), Expect = 3.8 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = -1 Query: 385 LSRGRGFSFLPGRGCAFRRGREQELS*RQLRFCGPPRARH 266 L +G G +LP GC + G + ++ ++ C + +H Sbjct: 233 LCKGDGKWYLPSGGCHCKPGYQADVEKQECTECPIGKFKH 272 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.2 bits (45), Expect = 5.0 Identities = 15/52 (28%), Positives = 20/52 (38%) Frame = +3 Query: 369 PLPRESARSPTLPRCQTCPLPS*RDCQGTSSRTATLPSRKEGALPSTVPVDR 524 PLP PT+P + P R S+ + EG + V VDR Sbjct: 431 PLPNMPGSMPTMPTMPSMAGPIRRRISDKSALSLAGGLYDEGTVRRRVAVDR 482 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.4 bits (43), Expect = 8.8 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -2 Query: 606 GPRALRLEHELSFQRGKVLAH 544 GP ++ + +E+S + KVL H Sbjct: 173 GPNSVGVSNEVSLPQFKVLGH 193 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.4 bits (43), Expect = 8.8 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +1 Query: 529 SPSRYMCQNLTPLKRKFMFQSKCTWPAPLPSREE 630 S RY N T + +S TWP L ++ E Sbjct: 373 SVGRYFYPNGTEKMTLSVNESNITWPGRLQTKPE 406 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 21.4 bits (43), Expect = 8.8 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -2 Query: 606 GPRALRLEHELSFQRGKVLAH 544 GP ++ + +E+S + KVL H Sbjct: 112 GPNSVGVSNEVSLPQFKVLGH 132 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,273 Number of Sequences: 438 Number of extensions: 3736 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -