BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30233 (712 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g62570.1 68416.m07029 DNAJ heat shock N-terminal domain-conta... 30 1.3 At1g70820.1 68414.m08169 phosphoglucomutase, putative / glucose ... 30 1.3 At1g52560.1 68414.m05933 26.5 kDa class I small heat shock prote... 29 2.3 At3g47620.1 68416.m05184 TCP family transcription factor, putati... 29 3.0 At1g20670.1 68414.m02589 DNA-binding bromodomain-containing prot... 29 3.0 At3g10810.1 68416.m01301 zinc finger (C3HC4-type RING finger) fa... 24 3.6 At3g01750.1 68416.m00112 ankyrin repeat family protein contains ... 29 4.0 At2g35910.1 68415.m04408 zinc finger (C3HC4-type RING finger) fa... 29 4.0 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 29 4.0 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 29 4.0 At1g03630.1 68414.m00343 protochlorophyllide reductase C, chloro... 28 5.3 At5g38560.1 68418.m04662 protein kinase family protein contains ... 28 7.0 At5g03490.1 68418.m00305 UDP-glucoronosyl/UDP-glucosyl transfera... 28 7.0 At3g22380.1 68416.m02825 expressed protein 28 7.0 At3g16785.1 68416.m02143 phospholipase D zeta1 / PLDzeta1 (PLDP1... 28 7.0 At5g18560.1 68418.m02194 AP2 domain-containing transcription fac... 27 9.3 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 27 9.3 At1g60220.1 68414.m06782 Ulp1 protease family protein contains P... 27 9.3 >At3g62570.1 68416.m07029 DNAJ heat shock N-terminal domain-containing protein contains Pfam profiles PF00226: DnaJ domain, PF00515: TPR Domain Length = 552 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +3 Query: 498 NLLPHTKSKSRAGSDGF-VIDEDLTDDSLQYLTDGREGTNQDRPQSW 635 NLL HTK+ R S GF D L DS+++ + +G + PQ + Sbjct: 232 NLLAHTKNLLRRRSAGFAAFDAGLFADSIRHFSKILDGRRRPAPQGF 278 >At1g70820.1 68414.m08169 phosphoglucomutase, putative / glucose phosphomutase, putative similar to phosphoglucomutase GI:534981 from [Spinacia oleracea], phosphomannomutase [Pseudomonas aeruginosa] GI:150994; contains InterPro accession IPR006352: Phosphoglucosamine mutase Length = 615 Score = 30.3 bits (65), Expect = 1.3 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -3 Query: 311 RVESWFVGTCCEFWWLCGCVVDMDD 237 +++ W +GTC + W GC+VD +D Sbjct: 508 KLKGWELGTCGDCWVTEGCLVDSND 532 >At1g52560.1 68414.m05933 26.5 kDa class I small heat shock protein-like (HSP26.5-P) contains Pfam profile: PF00011 Hsp20/alpha crystallin family; identified in Scharf, K-D., et al,Cell Stress & Chaperones (2001) 6: 225-237. Length = 232 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +1 Query: 406 SDRKSPRQKPHCFPSIKNRSSLWLNQD 486 S++KSPRQ FP + R SLW N D Sbjct: 60 SEKKSPRQN---FPRRRGRKSLWRNTD 83 >At3g47620.1 68416.m05184 TCP family transcription factor, putative auxin-induced basic helix-loop-helix transcription factor - Gossypium hirsutum, EMBL:AF165924 Length = 489 Score = 29.1 bits (62), Expect = 3.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 420 PKTEASLLSIHQEQVQPLVEPRPQHQNLLPHTKSK 524 P + +SL S+HQ Q +P+ Q Q P T K Sbjct: 59 PSSSSSLFSLHQHQQLSQSQPQSQSQKSQPQTTQK 93 >At1g20670.1 68414.m02589 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487 Length = 652 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +1 Query: 271 QNSQHVPTNQDSTRRHHHQASQTDSTITGNDLSCYHLNKRLSTLSSDRKSP 423 Q QH +QD HH+ +++ S N S H +KR + S+D SP Sbjct: 37 QQQQHKNNHQDDDDHHHNNNNRSGSK---NPNSLNHRSKRRNPNSNDGDSP 84 >At3g10810.1 68416.m01301 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 Zinc finger, C3HC4 type (RING finger) Length = 496 Score = 24.2 bits (50), Expect(2) = 3.6 Identities = 26/125 (20%), Positives = 42/125 (33%), Gaps = 6/125 (4%) Frame = +3 Query: 132 SQTASSAFRLLPPGGHADHSSPHRPDGLRSGRCNSIIHIHNTTTK-----PPELTTRPHK 296 S T S + P H H H + H HN + K P + PH+ Sbjct: 316 SSTKSPSPSPSPHSKHHHHHHHHHHHHHHHHHNHHHHHHHNLSPKMAPEVSPVASPAPHR 375 Query: 297 PGFYAPSSPPSVTDRFN-HYWQRFILLPLEQATQYTVIRPQEPKTEASLLSIHQEQVQPL 473 APS+PP H+ ++ + A + P + +S + + P+ Sbjct: 376 SRKRAPSAPPPCNPGNRVHFKEKRVQFSSTPAPAPSAGAPHHQLHSPAPISAAKSHIVPI 435 Query: 474 VEPRP 488 P P Sbjct: 436 SAPLP 440 Score = 23.0 bits (47), Expect(2) = 3.6 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +3 Query: 468 PLVEPRPQHQNLLPHTKSKSRAGS 539 P+ EPR H N + H + +S + + Sbjct: 451 PITEPREPHANEVAHPQPQSSSSA 474 >At3g01750.1 68416.m00112 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 664 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +1 Query: 382 NKRLSTLSSDRKSPRQKPHCFPSIKNRSS 468 NKR + S++ SPR K F S+++RSS Sbjct: 555 NKRTLAVRSNQSSPRAKKKRFGSVRSRSS 583 >At2g35910.1 68415.m04408 zinc finger (C3HC4-type RING finger) family protein low similarity to RING-H2 zinc finger protein ATL6 [Arabidopsis thaliana] GI:4928403; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 217 Score = 28.7 bits (61), Expect = 4.0 Identities = 17/50 (34%), Positives = 21/50 (42%) Frame = +1 Query: 292 TNQDSTRRHHHQASQTDSTITGNDLSCYHLNKRLSTLSSDRKSPRQKPHC 441 TNQDSTR HHH + G D ++ L S+ K P C Sbjct: 100 TNQDSTRIHHHHHHVIIDVVPGLDEDTIQSYPKI--LYSEAKGPTTASCC 147 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 28.7 bits (61), Expect = 4.0 Identities = 21/67 (31%), Positives = 25/67 (37%) Frame = +3 Query: 312 PSSPPSVTDRFNHYWQRFILLPLEQATQYTVIRPQEPKTEASLLSIHQEQVQPLVEPRPQ 491 PS PP TD ++ Y+Q P+ TQ P P S H P P PQ Sbjct: 14 PSGPPPPTDPYHQYYQHQARPPVPPPTQ-----PGGPPAWYSNQFHHPHSPSPPPPPPPQ 68 Query: 492 HQNLLPH 512 PH Sbjct: 69 WGPPSPH 75 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 28.7 bits (61), Expect = 4.0 Identities = 21/67 (31%), Positives = 25/67 (37%) Frame = +3 Query: 312 PSSPPSVTDRFNHYWQRFILLPLEQATQYTVIRPQEPKTEASLLSIHQEQVQPLVEPRPQ 491 PS PP TD ++ Y+Q P+ TQ P P S H P P PQ Sbjct: 14 PSGPPPPTDPYHQYYQHQARPPVPPPTQ-----PGGPPAWYSNQFHHPHSPSPPPPPPPQ 68 Query: 492 HQNLLPH 512 PH Sbjct: 69 WGPPSPH 75 >At1g03630.1 68414.m00343 protochlorophyllide reductase C, chloroplast / PCR C / NADPH-protochlorophyllide oxidoreductase C (PORC) identical to SP:O48741 protochlorophyllide reductase C, chloroplast precursor (EC 1.3.1.33) (PCR C) (NADPH-protochlorophyllide oxidoreductase C) (POR C) [Arabidopsis thaliana] Length = 401 Score = 28.3 bits (60), Expect = 5.3 Identities = 15/57 (26%), Positives = 29/57 (50%) Frame = +1 Query: 286 VPTNQDSTRRHHHQASQTDSTITGNDLSCYHLNKRLSTLSSDRKSPRQKPHCFPSIK 456 +P+ + AS ++T TG+ S + +++STL + ++ RQKP I+ Sbjct: 10 LPSTISIQKEGKFNASLKETTFTGSSFSNHLRAEKISTLLTIKEQRRQKPRFSTGIR 66 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 249 HNTTTKPPELTTRPHKPGFYAPSSPP 326 +++TT PP L T+P P P +PP Sbjct: 16 NSSTTAPPPLQTQPTTPSAPPPVTPP 41 >At5g03490.1 68418.m00305 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 465 Score = 27.9 bits (59), Expect = 7.0 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = +3 Query: 402 VIRPQEPKTEASLLSIHQEQVQPLVEPRPQHQNLLPHTKSKSRAGSDG 545 ++ P + LLS H V +V P P H +L P ++ G+ G Sbjct: 51 IVTPGNLTYLSPLLSAHPSSVTSVVFPFPPHPSLSPGVENVKDVGNSG 98 >At3g22380.1 68416.m02825 expressed protein Length = 1550 Score = 27.9 bits (59), Expect = 7.0 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = +2 Query: 233 LHHPYPQHNHKATRTHNTSPQTRILRAVITTKRHRPIQPLLAT 361 LHH + HN+ R +N P T++ R ++ P+ PL++T Sbjct: 157 LHHHHHSHNNNHQRKNN-FPPTKVFR---SSPSPAPVSPLVST 195 >At3g16785.1 68416.m02143 phospholipase D zeta1 / PLDzeta1 (PLDP1) identical to phospholipase D zeta1 [Arabidopsis thaliana] GI:15723315, SP|Q9LRZ5 Phospholipase D p1 (EC 3.1.4.4) (AtPLDp1) (Phospholipase D1 PHOX and PX containing domain) (Phospholipase D zeta 1) (PLDzeta1) {Arabidopsis thaliana}; supported by cDNA gi:15723314; non-consensus splice site (GC) at the beginning of first intron. Length = 1096 Score = 27.9 bits (59), Expect = 7.0 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 237 IIHIHNTTTKPPELTTRPHKPGFYAPSSPPSVTD 338 + I++ +PPE PH+ G YAP P +TD Sbjct: 334 VASINDAALRPPEGWCHPHRFGSYAP--PRGLTD 365 >At5g18560.1 68418.m02194 AP2 domain-containing transcription factor, putative AP2/EREBP-like transcription factor LEAFY PETIOLE, Arabidopsis thaliana, EMBL:AF216581 Length = 348 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 236 HHPYPQHNHKATRTHNTSPQTRILRAVITTK-RHRPI 343 HHP+ Q+ H+ + +T PQT + A T RH+ + Sbjct: 152 HHPHYQNYHQPQQPKHTLPQTVLPAASFKTPVRHQSV 188 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 27.5 bits (58), Expect = 9.3 Identities = 16/54 (29%), Positives = 24/54 (44%) Frame = +3 Query: 165 PPGGHADHSSPHRPDGLRSGRCNSIIHIHNTTTKPPELTTRPHKPGFYAPSSPP 326 PP +SSP P + + +I+N+ +PP + P P F S PP Sbjct: 55 PPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPP 108 >At1g60220.1 68414.m06782 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 604 Score = 27.5 bits (58), Expect = 9.3 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 144 SSAFRLLPPGGHADHSSPHRPDGLRSGRCN 233 S+ +RLLP G A+HS+ GL+ + N Sbjct: 231 SNGWRLLPDVGKAEHSAKQFDSGLKESKGN 260 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,189,875 Number of Sequences: 28952 Number of extensions: 363115 Number of successful extensions: 1436 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1298 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1434 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1535986264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -