BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30232 (701 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18663| Best HMM Match : zf-C2H2 (HMM E-Value=4.5e-28) 28 6.4 SB_56248| Best HMM Match : RVT_1 (HMM E-Value=8.6e-20) 28 6.4 >SB_18663| Best HMM Match : zf-C2H2 (HMM E-Value=4.5e-28) Length = 693 Score = 28.3 bits (60), Expect = 6.4 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = -1 Query: 698 CPKFFFLNGKIILHFKVSYYIRSDKLQNCYCCNCSHKRFCYFT*K 564 CPK F + G H++ Y++RS Q Y C K+F Y K Sbjct: 255 CPKAFHMMG----HYQ--YHVRSHTGQKPYSCEICGKKFSYLNNK 293 >SB_56248| Best HMM Match : RVT_1 (HMM E-Value=8.6e-20) Length = 1193 Score = 28.3 bits (60), Expect = 6.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 95 NESQNNPERCSNVGRVRSHQLCM 163 N+ NN E+C N GR+ C+ Sbjct: 183 NDKSNNAEKCGNCGRIHDKDNCI 205 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,137,656 Number of Sequences: 59808 Number of extensions: 353730 Number of successful extensions: 951 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 876 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 950 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -