BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30228 (718 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 25 3.1 AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 24 4.1 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 24 5.4 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 24 5.4 AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinestera... 24 5.4 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 24.6 bits (51), Expect = 3.1 Identities = 7/31 (22%), Positives = 15/31 (48%) Frame = +3 Query: 591 CWVWHK*TANYVCHRGRQSFCWIC*QKKFKI 683 C WH +Y C+R + W ++ +++ Sbjct: 188 CRYWHSLRLSYACYRAKHRQDWAAQKRTYEL 218 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 24.2 bits (50), Expect = 4.1 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 514 RFIIPWLDIKENRGLGNESWFLRL 443 R I P+LD++EN G G+ F+ L Sbjct: 77 RIIDPYLDLEENWGRGHIKRFVGL 100 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 23.8 bits (49), Expect = 5.4 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -2 Query: 621 NLQFIYAIPNRHKFGGSPEKAFHF-NSAYLVFHFLHI 514 NL + N H+FGG P + F SA V LH+ Sbjct: 334 NLALRWVRDNIHRFGGDPSRVTLFGESAGAVSVSLHL 370 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 23.8 bits (49), Expect = 5.4 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -2 Query: 621 NLQFIYAIPNRHKFGGSPEKAFHF-NSAYLVFHFLHI 514 NL + N H+FGG P + F SA V LH+ Sbjct: 334 NLALRWVRDNIHRFGGDPSRVTLFGESAGAVSVSLHL 370 >AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinesterase protein. Length = 623 Score = 23.8 bits (49), Expect = 5.4 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -2 Query: 621 NLQFIYAIPNRHKFGGSPEKAFHF-NSAYLVFHFLHI 514 NL + N H+FGG P + F SA V LH+ Sbjct: 220 NLALRWVRDNIHRFGGDPSRVTLFGESAGAVSVSLHL 256 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 712,061 Number of Sequences: 2352 Number of extensions: 14753 Number of successful extensions: 26 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 72765525 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -