BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30227 (729 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 6e-19 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 63 3e-10 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 60 1e-09 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 58 1e-08 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 52 6e-07 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 49 4e-06 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 44 1e-04 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 36 0.044 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 34 0.10 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 34 0.10 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 31 0.72 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 31 0.96 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) 30 1.7 SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_26138| Best HMM Match : RhoGEF (HMM E-Value=0.0011) 29 3.9 SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) 29 3.9 SB_44832| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) 28 8.9 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 28 8.9 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 91.5 bits (217), Expect = 6e-19 Identities = 52/149 (34%), Positives = 75/149 (50%) Frame = +1 Query: 241 PRLGFVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPD 420 P + +PFNKNFY+ HP + K+S E+++ R K + VSG P F F + Sbjct: 467 PEKSKIDYKPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDE 526 Query: 421 YVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LA*PKRVPGKTLGLHLASHCAHK*PKPPI 600 + ++ + Y +PT IQ Q PIA+SG+ + K GKT L H +P + Sbjct: 527 QMMASIRKLEYTQPTQIQCQALPIALSGRDIIGIAKTGSGKTAAF-LWPALVHIMDQPEL 585 Query: 601 RRGDGPIALVLALPES*HQQIQAKFAARF 687 + GDGPI L+ A QQI + A RF Sbjct: 586 QVGDGPIVLICAPTRELCQQIYTE-ARRF 613 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 62.9 bits (146), Expect = 3e-10 Identities = 40/131 (30%), Positives = 61/131 (46%) Frame = +1 Query: 271 FNKNFYDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 450 F ++YD + V + S V+E R K+ + + G + PI+ F + N P + + Sbjct: 32 FMWSYYDENEKVSRLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKN 91 Query: 451 YKEPTPIQAQGWPIAMSGKI*LA*PKRVPGKTLGLHLASHCAHK*PKPPIRRGDGPIALV 630 ++ PTPIQ Q MSG+ + + GKTL L C K P GD P+AL+ Sbjct: 92 FQVPTPIQMQSLSCVMSGRDIIGLAETGSGKTLAYSLPL-CMLLRTKAPSNPGDTPVALI 150 Query: 631 LALPES*HQQI 663 L QQ+ Sbjct: 151 LTPTRELMQQV 161 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/56 (48%), Positives = 36/56 (64%) Frame = +1 Query: 313 RSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQ 480 R +EV+ YR ++TV+G V P+ FEE+ FPDY+Q K G+ EPT IQAQ Sbjct: 57 RGQHEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ 112 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 58.8 bits (136), Expect = 4e-09 Identities = 34/107 (31%), Positives = 54/107 (50%), Gaps = 1/107 (0%) Frame = +1 Query: 256 VSLQPFNKNFYDPHPTVLKRSPYEVEEYRNKHE-VTVSGVEVHNPIQYFEEANFPDYVQQ 432 V QPF K+FY P + K +P E +E+R E + V G P++ + + + Sbjct: 59 VVYQPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKILD 118 Query: 433 GVKTMGYKEPTPIQAQGWPIAMSGKI*LA*PKRVPGKTLGLHLASHC 573 +K Y++PTPIQAQ P+ MSG+ +A P + L + + C Sbjct: 119 VLKKNSYEKPTPIQAQAIPVIMSGRDMIA-IVMTPTRELAIQIHREC 164 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/74 (33%), Positives = 42/74 (56%) Frame = +1 Query: 286 YDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPT 465 Y HPT+ + +V++ R+K E+ V G V +P+ F +F + + + + GY PT Sbjct: 161 YKEHPTIAALTAEQVKQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPT 220 Query: 466 PIQAQGWPIAMSGK 507 PIQ Q P+ +SG+ Sbjct: 221 PIQMQVLPVLLSGR 234 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 51.6 bits (118), Expect = 6e-07 Identities = 35/114 (30%), Positives = 54/114 (47%), Gaps = 4/114 (3%) Frame = +1 Query: 337 YRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*L 516 +R ++ G + PI+ ++EA PD + + V +GYK+PTPIQ Q PI + + + Sbjct: 83 FREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNRDII 142 Query: 517 A*PKRVPGKTLGLHLASHCAHK*PKPPIRRGD----GPIALVLALPES*HQQIQ 666 + GKT + P I R + GP AL+LA QQI+ Sbjct: 143 GVAETGSGKTAAFAIPL-LVWIMGLPKIERDNDADQGPYALILAPTRELAQQIE 195 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 4/64 (6%) Frame = +1 Query: 325 EVEEYRNKHEVTVSGVEVHNPIQYF----EEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 492 ++ +R++ + V G +V +P++ F E FPDY+ V+ GY PTPIQ Q P+ Sbjct: 137 KINLFRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQATPL 196 Query: 493 AMSG 504 G Sbjct: 197 MAHG 200 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 44.0 bits (99), Expect = 1e-04 Identities = 27/72 (37%), Positives = 39/72 (54%) Frame = +1 Query: 331 EEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI 510 E+Y ++ EV VSG I FEEAN + V+ YK+PTP+Q PI ++G+ Sbjct: 692 EKY-DQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRD 750 Query: 511 *LA*PKRVPGKT 546 +A + GKT Sbjct: 751 VMACAQTGSGKT 762 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 44.0 bits (99), Expect = 1e-04 Identities = 27/72 (37%), Positives = 39/72 (54%) Frame = +1 Query: 331 EEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI 510 E+Y ++ EV VSG I FEEAN + V+ YK+PTP+Q PI ++G+ Sbjct: 115 EKY-DQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRD 173 Query: 511 *LA*PKRVPGKT 546 +A + GKT Sbjct: 174 VMACAQTGSGKT 185 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/62 (33%), Positives = 30/62 (48%) Frame = +1 Query: 361 VSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LA*PKRVPG 540 VSG I F E F + + + GY+ PTP+Q PI M+G+ +A + G Sbjct: 469 VSGENQPPKITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGRDLMACAQTGSG 528 Query: 541 KT 546 KT Sbjct: 529 KT 530 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 35.5 bits (78), Expect = 0.044 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +1 Query: 388 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LA*PKRVPGKTL 549 ++ F + G+ G+ PT IQ QG P+A+SG+ L K GKTL Sbjct: 49 VEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGRDVLGAAKTGSGKTL 102 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 34.3 bits (75), Expect = 0.10 Identities = 17/50 (34%), Positives = 28/50 (56%) Frame = +1 Query: 397 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LA*PKRVPGKT 546 FE+ + G+ G+ +P+PIQ + P+A++G+ LA K GKT Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGKT 98 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 34.3 bits (75), Expect = 0.10 Identities = 17/50 (34%), Positives = 28/50 (56%) Frame = +1 Query: 397 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LA*PKRVPGKT 546 FE+ + G+ G+ +P+PIQ + P+A++G+ LA K GKT Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGKT 98 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 32.3 bits (70), Expect = 0.41 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = +1 Query: 388 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LA*PKRVPGKT 546 I FE+ + + + V GYK+PTP+Q PI + +A + GKT Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKRDLMACAQTGSGKT 926 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 31.5 bits (68), Expect = 0.72 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = +1 Query: 430 QGVKTMGYKEPTPIQAQGWPIAMSGKI*LA*PKRVPGKTLGLHL 561 + V +G+ PTPIQA P+A+ GK A GKT L Sbjct: 23 RAVNELGFLHPTPIQASTIPVALMGKDVCACAATGTGKTAAFML 66 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 31.1 bits (67), Expect = 0.96 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 3/55 (5%) Frame = +1 Query: 346 KHEVTVSGVEVHNPI---QYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMS 501 KHEV V + +P+ + FEE +++GV MG+ +P+ IQ P+ ++ Sbjct: 85 KHEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLA 139 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +1 Query: 373 EVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGW 486 ++H P++ + FP Y + Y P P QA W Sbjct: 6 DIHGPVRKLHKHGFPGYEEDYAAVFKYPTPWPEQAMEW 43 >SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 29 Score = 30.3 bits (65), Expect = 1.7 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -3 Query: 268 VGVKQIPIWASHVLPSREF 212 VGV+ I WAS++LPSR+F Sbjct: 10 VGVRDIEQWASNLLPSRQF 28 >SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) Length = 505 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = +1 Query: 319 PYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 450 P+E + + KH++ V+ VE + +Q +E F + ++Q VK G Sbjct: 252 PFEPPKPKTKHKLDVATVEDYKKLQEYEREKFTEMIKQ-VKDTG 294 >SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 29.1 bits (62), Expect = 3.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -2 Query: 203 HQSLQILQIYCHRCQTETNYRRICCLLQIWNHRFHGY 93 H L YC RC T CCLLQ++++ ++G+ Sbjct: 484 HLQQPSLAAYC-RCITILTTAIACCLLQVYHNTYNGH 519 >SB_26138| Best HMM Match : RhoGEF (HMM E-Value=0.0011) Length = 1199 Score = 29.1 bits (62), Expect = 3.9 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 227 QNMRRPDWDLFHSNLSTKTFMIHILQFSKD 316 +N RR WD FHSN+S + H+ F D Sbjct: 768 RNKRR--WDSFHSNVSADSGSAHMFDFDTD 795 >SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) Length = 675 Score = 29.1 bits (62), Expect = 3.9 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +1 Query: 331 EEYRNK-HEVTVSGVEVHNPIQYFEEANFPDY 423 EE NK H++ + + +HNP YFE+ + DY Sbjct: 234 EEVNNKLHKILIVNM-IHNPFNYFEKKSPTDY 264 >SB_44832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 27.9 bits (59), Expect = 8.9 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 278 LLKGWSETNPNLGVACSAL 222 LLKGW TN N +AC+A+ Sbjct: 150 LLKGWGATNFNHAMACAAV 168 >SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) Length = 401 Score = 27.9 bits (59), Expect = 8.9 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Frame = -2 Query: 269 GWSETNPNLGVACS--ALQRILFSHQSLQILQIYCHRCQTETNYRRICCLLQIWN-HRFH 99 GW T + S AL+RI + ++ C +YRR CC L +W H + Sbjct: 181 GWRVTLRVIAATTSQQALERIATPVTTSKLRCSTTQECCVRVDYRRKCC-LHVWRVHTTN 239 Query: 98 GYYSN 84 Y+S+ Sbjct: 240 TYWSS 244 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 27.9 bits (59), Expect = 8.9 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +1 Query: 430 QGVKTMGYKEPTPIQAQGWPIAMSGKI*LA*PKRVPGKT 546 +G+ G+++P+PIQ + P+ G +A K GKT Sbjct: 26 RGLNEAGFEKPSPIQLKAIPLGRCGLDLIAQAKSGTGKT 64 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,932,118 Number of Sequences: 59808 Number of extensions: 499223 Number of successful extensions: 1336 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 1234 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1328 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -