BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30227 (729 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 40 6e-05 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 25 1.8 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 25 2.4 AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. 23 7.3 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 23 7.3 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 9.7 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 40.3 bits (90), Expect = 6e-05 Identities = 22/70 (31%), Positives = 35/70 (50%) Frame = +1 Query: 352 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKI*LA*PKR 531 +V VSG + ++ FE + + V V+ Y +PTPIQ PI ++G+ +A + Sbjct: 161 QVRVSGENPPDHVESFERSGLREEVMTNVRKSSYTKPTPIQRYAIPIILNGRDLMACAQT 220 Query: 532 VPGKTLGLHL 561 GKT L Sbjct: 221 GSGKTAAFML 230 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 25.4 bits (53), Expect = 1.8 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -3 Query: 154 RRIIAEFVASSKFGTTVSTAIIPITRHDYFSDLVEDVYLNYGFFLTQ 14 RR+ A+ A ++F I+ YF D+V DV L Y + Q Sbjct: 59 RRVRAKSKAMTEFLPLCDVLFNVISLAGYFCDVVFDVVLGYALYERQ 105 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 25.0 bits (52), Expect = 2.4 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 6/38 (15%) Frame = -2 Query: 227 ALQRILFSHQSLQILQ------IYCHRCQTETNYRRIC 132 A +R+ SHQS IL+ I CHRC+ + +R C Sbjct: 180 AQKRMEKSHQSESILRVGPEKKITCHRCRKPGHMKRDC 217 >AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. Length = 304 Score = 23.4 bits (48), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 116 WNHRFHGYYSNY 81 W R HGYY+NY Sbjct: 197 WIIRPHGYYANY 208 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.4 bits (48), Expect = 7.3 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +1 Query: 304 VLKRSPYEVEEYRNKHEVTVSGVEVHNPIQY 396 V++R P V+ + H+V V VH P+ + Sbjct: 139 VVRREPSAVKIAQPVHKVIAQPVHVHAPVAH 169 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 9.7 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = -3 Query: 712 NIKNGVSPKIWQQTW 668 ++ NG PK W+++W Sbjct: 587 SLANGYFPKAWRKSW 601 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 783,555 Number of Sequences: 2352 Number of extensions: 16977 Number of successful extensions: 32 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -