BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30225 (700 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC794.03 |||amino acid permease, unknown 13|Schizosaccharomyce... 29 0.85 SPAC2E1P3.02c |amt3||ammonium transporter Amt3|Schizosaccharomyc... 28 1.5 SPBC32H8.13c |mok12||alpha-1,3-glucan synthase Mok12|Schizosacch... 27 2.0 >SPCC794.03 |||amino acid permease, unknown 13|Schizosaccharomyces pombe|chr 3|||Manual Length = 554 Score = 28.7 bits (61), Expect = 0.85 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +3 Query: 267 VSCVLDIAFHLLTVAIVTDGFQCDVNYDKFSAIPWAVVEPLLLV 398 V+C F + + GF + KF A+ WAV E +LLV Sbjct: 145 VNCQSTTKFIFGELPVFNSGFSVSSSDVKFRAVQWAVGEAILLV 188 Score = 25.8 bits (54), Expect = 6.0 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 527 VDILNFLINLIWLRIVVS 580 V +L+F++N+IWL I VS Sbjct: 210 VILLDFVLNMIWLPIAVS 227 >SPAC2E1P3.02c |amt3||ammonium transporter Amt3|Schizosaccharomyces pombe|chr 1|||Manual Length = 517 Score = 27.9 bits (59), Expect = 1.5 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = +2 Query: 110 IQSTIKLLLWVCVVNCVQFFQLETFSQWFYTSLACAVESNYALYVSSSLSAFGV-LCLG 283 I S + L++ +V C Q + + W YT A +++SS +A LCLG Sbjct: 150 IPSLVISFLYITLVYCPQAYWTWAPNGWLYTLGALDFAGGGPVHISSGFAALAYSLCLG 208 >SPBC32H8.13c |mok12||alpha-1,3-glucan synthase Mok12|Schizosaccharomyces pombe|chr 2|||Manual Length = 2352 Score = 27.5 bits (58), Expect = 2.0 Identities = 14/54 (25%), Positives = 25/54 (46%) Frame = +2 Query: 167 FQLETFSQWFYTSLACAVESNYALYVSSSLSAFGVLCLGYSVSSADSCYCH*WL 328 F L + +F + AC+V + A YV + S+ G L ++ + H W+ Sbjct: 2008 FILVAITHFFQKTTACSVIQHIAAYVYAISSSTGSLYFAWNFGAEGGIATHHWI 2061 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,263,939 Number of Sequences: 5004 Number of extensions: 72711 Number of successful extensions: 183 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 183 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -