BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30222 (710 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21) 82 5e-16 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) 36 0.043 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.043 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 35 0.057 SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.057 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.075 SB_59134| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.075 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 35 0.075 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.075 SB_26328| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.075 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 34 0.099 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.099 SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5) 34 0.099 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 34 0.099 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 34 0.13 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 34 0.13 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 34 0.13 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 34 0.13 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 34 0.13 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_26690| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_13739| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 34 0.13 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 33 0.17 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 33 0.17 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 33 0.17 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 33 0.17 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 33 0.17 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 33 0.17 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 33 0.17 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 33 0.17 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_13007| Best HMM Match : DUF1566 (HMM E-Value=6.2) 33 0.17 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 33 0.23 SB_31585| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) 33 0.23 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 33 0.23 SB_45832| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_28253| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_21182| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_8705| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 33 0.30 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 33 0.30 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 33 0.30 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 33 0.30 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 33 0.30 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 33 0.30 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 33 0.30 SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 33 0.30 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 33 0.30 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 33 0.30 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 33 0.30 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 33 0.30 SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 33 0.30 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 33 0.30 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 33 0.30 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 33 0.30 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 33 0.30 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 33 0.30 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 33 0.30 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 33 0.30 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 33 0.30 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 33 0.30 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 33 0.30 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 33 0.30 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 33 0.30 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 33 0.30 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_17046| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 33 0.30 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) 33 0.30 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 33 0.30 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 33 0.30 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 33 0.30 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 33 0.30 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 33 0.30 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 33 0.30 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 33 0.30 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 33 0.30 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 33 0.30 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 33 0.30 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 33 0.30 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 33 0.30 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 33 0.30 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 33 0.30 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 33 0.30 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 33 0.30 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 33 0.30 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 33 0.30 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 33 0.30 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_48925| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 >SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21) Length = 147 Score = 81.8 bits (193), Expect = 5e-16 Identities = 40/64 (62%), Positives = 50/64 (78%) Frame = +1 Query: 517 RKTCYAQHTQVRAIRKKMCEIITRDVTNSELREVVNKLIPDSIAKGHREGPAMGIYPLRD 696 +KT YA+HTQ++AIRKKM +IITR+V+ ++L+EVVNKLIPDSI K E IYPL D Sbjct: 34 KKTAYAKHTQIKAIRKKMVDIITREVSTNDLKEVVNKLIPDSIGK-DIEKSCQSIYPLHD 92 Query: 697 VCIR 708 V IR Sbjct: 93 VHIR 96 Score = 50.8 bits (116), Expect = 1e-06 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = +2 Query: 422 TLIEANIDVKTTDGYVLRVFCIGFTNK 502 TLIEA +DVKTTDGY+LR+FCIGFT + Sbjct: 2 TLIEAAVDVKTTDGYLLRMFCIGFTKR 28 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 37.1 bits (82), Expect = 0.014 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -1 Query: 80 FIFPRAEFLQPGGSTSSRA 24 FI+P EFLQPGGSTSSRA Sbjct: 110 FIYPGIEFLQPGGSTSSRA 128 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.3 bits (80), Expect = 0.025 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +1 Query: 25 ALELVDPPGCRNSARGK 75 ALELVDPPGCRNS GK Sbjct: 88 ALELVDPPGCRNSIAGK 104 >SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 35.9 bits (79), Expect = 0.032 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = -1 Query: 131 WVDNLLLNTFFTALRQAFIFPRAEFLQPGGSTSSRA 24 + D L+ F + + + + EFLQPGGSTSSRA Sbjct: 4 FTDTLISANIFEGKKLKYTWQKIEFLQPGGSTSSRA 39 >SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) Length = 175 Score = 35.5 bits (78), Expect = 0.043 Identities = 17/39 (43%), Positives = 22/39 (56%) Frame = -1 Query: 140 ASEWVDNLLLNTFFTALRQAFIFPRAEFLQPGGSTSSRA 24 A W+ L + + + P+ EFLQPGGSTSSRA Sbjct: 27 ALTWLIALGITLIYYVFKYELKAPKIEFLQPGGSTSSRA 65 >SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 35.5 bits (78), Expect = 0.043 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +1 Query: 25 ALELVDPPGCRNSARGKIK 81 ALELVDPPGCRNS + K++ Sbjct: 12 ALELVDPPGCRNSMKMKVE 30 >SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) Length = 106 Score = 35.1 bits (77), Expect = 0.057 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = +1 Query: 25 ALELVDPPGCRNSARGKIK 81 ALELVDPPGCRNS + + K Sbjct: 12 ALELVDPPGCRNSMKQRFK 30 >SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 35.1 bits (77), Expect = 0.057 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = -1 Query: 131 WVDNLLLNTFFTALRQAFIFPRAEFLQPGGSTSSRA 24 + D L+ L + P EFLQPGGSTSSRA Sbjct: 4 FTDTLISANILIPLTYPYYTPPIEFLQPGGSTSSRA 39 >SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 34.7 bits (76), Expect = 0.075 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 71 PRAEFLQPGGSTSSRA 24 PR EFLQPGGSTSSRA Sbjct: 40 PRIEFLQPGGSTSSRA 55 >SB_59134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 34.7 bits (76), Expect = 0.075 Identities = 20/47 (42%), Positives = 27/47 (57%) Frame = -1 Query: 164 SLDIVPIFASEWVDNLLLNTFFTALRQAFIFPRAEFLQPGGSTSSRA 24 S IV + + L+ F+++ F+F EFLQPGGSTSSRA Sbjct: 14 SCSIVMLVLLSDLPKALIRRVFSSML-LFVFNCIEFLQPGGSTSSRA 59 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 34.7 bits (76), Expect = 0.075 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +1 Query: 25 ALELVDPPGCRNSARGK 75 ALELVDPPGCRNS + K Sbjct: 12 ALELVDPPGCRNSIKDK 28 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 34.7 bits (76), Expect = 0.075 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +1 Query: 25 ALELVDPPGCRNSARG 72 ALELVDPPGCRNS G Sbjct: 12 ALELVDPPGCRNSIEG 27 >SB_26328| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 34.7 bits (76), Expect = 0.075 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = -1 Query: 110 NTFFTALRQAFIFPRAEFLQPGGSTSSRA 24 +T +A ++ +P EFLQPGGSTSSRA Sbjct: 6 DTLISANIESHPYPDIEFLQPGGSTSSRA 34 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 34.3 bits (75), Expect = 0.099 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +1 Query: 25 ALELVDPPGCRNSAR 69 ALELVDPPGCRNS R Sbjct: 12 ALELVDPPGCRNSIR 26 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 34.3 bits (75), Expect = 0.099 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +1 Query: 25 ALELVDPPGCRNSAR 69 ALELVDPPGCRNS R Sbjct: 12 ALELVDPPGCRNSIR 26 >SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5) Length = 149 Score = 34.3 bits (75), Expect = 0.099 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 77 IFPRAEFLQPGGSTSSRA 24 I+ R EFLQPGGSTSSRA Sbjct: 22 IYARIEFLQPGGSTSSRA 39 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 34.3 bits (75), Expect = 0.099 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +1 Query: 25 ALELVDPPGCRNSARG 72 ALELVDPPGCRNS G Sbjct: 99 ALELVDPPGCRNSITG 114 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 25 VSNSCSPGDPLVLER 39 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 348 VSNSCSPGDPLVLER 362 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 33.9 bits (74), Expect = 0.13 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = -1 Query: 74 FPRAEFLQPGGSTSSRA 24 F R EFLQPGGSTSSRA Sbjct: 48 FSRIEFLQPGGSTSSRA 64 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 30 VSNSCSPGDPLVLER 44 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 33.9 bits (74), Expect = 0.13 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -1 Query: 104 FFTALRQAFIFPRAEFLQPGGSTSSRA 24 F L A I R EFLQPGGSTSSRA Sbjct: 4 FTDTLISANIVLRIEFLQPGGSTSSRA 30 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 7 VSNSCSPGDPLVLER 21 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 10 VSNSCSPGDPLVLER 24 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 15 VSNSCSPGDPLVLER 29 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 33.9 bits (74), Expect = 0.13 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = -1 Query: 98 TALRQAFIFPRAEFLQPGGSTSSRA 24 T + +F + EFLQPGGSTSSRA Sbjct: 83 TRSMRPLVFGKIEFLQPGGSTSSRA 107 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 4 VSNSCSPGDPLVLER 18 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 2 VSNSCSPGDPLVLER 16 >SB_30021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 61 NSCSPGDPLVLERXA 17 NSCSPGDPLVLER A Sbjct: 56 NSCSPGDPLVLERAA 70 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 18 VSNSCSPGDPLVLER 32 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 40 VSNSCSPGDPLVLER 54 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 117 VSNSCSPGDPLVLER 131 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 184 VSNSCSPGDPLVLER 198 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 34 VSNSCSPGDPLVLER 48 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 1066 VSNSCSPGDPLVLER 1080 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 3 VSNSCSPGDPLVLER 17 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 214 VSNSCSPGDPLVLER 228 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 78 VSNSCSPGDPLVLER 92 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 32 VSNSCSPGDPLVLER 46 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 3475 VSNSCSPGDPLVLER 3489 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 5 VSNSCSPGDPLVLER 19 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 10 VSNSCSPGDPLVLER 24 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 3 VSNSCSPGDPLVLER 17 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = +1 Query: 25 ALELVDPPGCRNSARGKIK 81 ALELVDPPGCRNS + +K Sbjct: 67 ALELVDPPGCRNSMKVCVK 85 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 7 VSNSCSPGDPLVLER 21 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 64 VSNSCSPGDPLVLER 78 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 4 VSNSCSPGDPLVLER 18 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 8 VSNSCSPGDPLVLER 22 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 19 VSNSCSPGDPLVLER 33 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 4 VSNSCSPGDPLVLER 18 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 11 VSNSCSPGDPLVLER 25 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +1 Query: 25 ALELVDPPGCRNSARG 72 ALELVDPPGCRNS G Sbjct: 29 ALELVDPPGCRNSIDG 44 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 25 VSNSCSPGDPLVLER 39 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 15 VSNSCSPGDPLVLER 29 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 12 VSNSCSPGDPLVLER 26 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 6 VSNSCSPGDPLVLER 20 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 10 VSNSCSPGDPLVLER 24 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 59 VSNSCSPGDPLVLER 73 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 3 VSNSCSPGDPLVLER 17 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 2 VSNSCSPGDPLVLER 16 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 31 VSNSCSPGDPLVLER 45 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 20 VSNSCSPGDPLVLER 34 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 4 VSNSCSPGDPLVLER 18 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 41 VSNSCSPGDPLVLER 55 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 15 VSNSCSPGDPLVLER 29 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 4 VSNSCSPGDPLVLER 18 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 14 VSNSCSPGDPLVLER 28 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 6 VSNSCSPGDPLVLER 20 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 15 VSNSCSPGDPLVLER 29 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 18 VSNSCSPGDPLVLER 32 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 30 VSNSCSPGDPLVLER 44 >SB_26690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 33.9 bits (74), Expect = 0.13 Identities = 19/32 (59%), Positives = 22/32 (68%) Frame = -1 Query: 119 LLLNTFFTALRQAFIFPRAEFLQPGGSTSSRA 24 +L+NT T +R I EFLQPGGSTSSRA Sbjct: 20 ILVNTPITGIRLNLI----EFLQPGGSTSSRA 47 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 32 VSNSCSPGDPLVLER 46 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 27 VSNSCSPGDPLVLER 41 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 10 VSNSCSPGDPLVLER 24 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 86 VSNSCSPGDPLVLER 100 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 17 VSNSCSPGDPLVLER 31 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 14 VSNSCSPGDPLVLER 28 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 34 VSNSCSPGDPLVLER 48 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 14 VSNSCSPGDPLVLER 28 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 27 VSNSCSPGDPLVLER 41 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 8 VSNSCSPGDPLVLER 22 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 7 VSNSCSPGDPLVLER 21 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 10 VSNSCSPGDPLVLER 24 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 23 VSNSCSPGDPLVLER 37 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 18 VSNSCSPGDPLVLER 32 >SB_13739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 74 FPRAEFLQPGGSTSSRA 24 +P EFLQPGGSTSSRA Sbjct: 32 YPNIEFLQPGGSTSSRA 48 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 2 VSNSCSPGDPLVLER 16 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 28 VSNSCSPGDPLVLER 42 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 27 VSNSCSPGDPLVLER 41 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 193 VSNSCSPGDPLVLER 207 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 9 VSNSCSPGDPLVLER 23 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 17 VSNSCSPGDPLVLER 31 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 V NSCSPGDPLVLER Sbjct: 10 VSNSCSPGDPLVLER 24 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 5 ISNSCSPGDPLVLER 19 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 101 ISNSCSPGDPLVLER 115 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 34 ISNSCSPGDPLVLER 48 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 33.5 bits (73), Expect = 0.17 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +1 Query: 25 ALELVDPPGCRNSARG 72 ALELVDPPGCRNS G Sbjct: 12 ALELVDPPGCRNSMIG 27 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 261 ISNSCSPGDPLVLER 275 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 18 ISNSCSPGDPLVLER 32 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 18 ISNSCSPGDPLVLER 32 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 16 ISNSCSPGDPLVLER 30 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 33.5 bits (73), Expect = 0.17 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +1 Query: 25 ALELVDPPGCRNSARGKIK 81 ALELVDPPGCRNS + K Sbjct: 12 ALELVDPPGCRNSMKPAAK 30 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 21 ISNSCSPGDPLVLER 35 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 120 ISNSCSPGDPLVLER 134 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 38 ISNSCSPGDPLVLER 52 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 59 ISNSCSPGDPLVLER 73 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 9 ISNSCSPGDPLVLER 23 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 10 ISNSCSPGDPLVLER 24 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 3 ISNSCSPGDPLVLER 17 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 33.5 bits (73), Expect = 0.17 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 25 ALELVDPPGCRNSARGKI 78 ALELVDPPGCRNS K+ Sbjct: 12 ALELVDPPGCRNSIVTKV 29 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 13 ISNSCSPGDPLVLER 27 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 4 ISNSCSPGDPLVLER 18 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 15 ISNSCSPGDPLVLER 29 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 52 ISNSCSPGDPLVLER 66 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 51 ISNSCSPGDPLVLER 65 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 16 ISNSCSPGDPLVLER 30 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 9 ISNSCSPGDPLVLER 23 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 21 ISNSCSPGDPLVLER 35 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 152 ISNSCSPGDPLVLER 166 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 4 ISNSCSPGDPLVLER 18 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 47 ISNSCSPGDPLVLER 61 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 34 ISNSCSPGDPLVLER 48 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 7 ISNSCSPGDPLVLER 21 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 4 ISNSCSPGDPLVLER 18 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 15 ISNSCSPGDPLVLER 29 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 32 ISNSCSPGDPLVLER 46 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 14 ISNSCSPGDPLVLER 28 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 34 ISNSCSPGDPLVLER 48 >SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.5 bits (73), Expect = 0.17 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -1 Query: 71 PRAEFLQPGGSTSSRA 24 P+ EFLQPGGSTSSRA Sbjct: 6 PKIEFLQPGGSTSSRA 21 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 34 ISNSCSPGDPLVLER 48 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +1 Query: 25 ALELVDPPGCRNSARGK 75 ALELVDPPGCRNS + + Sbjct: 12 ALELVDPPGCRNSIQAR 28 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 18 ISNSCSPGDPLVLER 32 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 32 ISNSCSPGDPLVLER 46 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 25 ISNSCSPGDPLVLER 39 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 974 ISNSCSPGDPLVLER 988 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 6 ISNSCSPGDPLVLER 20 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 34 ISNSCSPGDPLVLER 48 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 34 ISNSCSPGDPLVLER 48 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 6 ISNSCSPGDPLVLER 20 >SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 1 ISNSCSPGDPLVLER 15 >SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 5 ISNSCSPGDPLVLER 19 >SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 5 ISNSCSPGDPLVLER 19 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +1 Query: 25 ALELVDPPGCRNSARGKI 78 ALELVDPPGCRNS + Sbjct: 12 ALELVDPPGCRNSMNANV 29 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 6 ISNSCSPGDPLVLER 20 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 32 ISNSCSPGDPLVLER 46 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 41 ISNSCSPGDPLVLER 55 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 34 ISNSCSPGDPLVLER 48 >SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 116 ISNSCSPGDPLVLER 130 >SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 2 ISNSCSPGDPLVLER 16 >SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 2 ISNSCSPGDPLVLER 16 >SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 14 ISNSCSPGDPLVLER 28 >SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 2 ISNSCSPGDPLVLER 16 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 71 ISNSCSPGDPLVLER 85 >SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 8 ISNSCSPGDPLVLER 22 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 2 ISNSCSPGDPLVLER 16 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 35 ISNSCSPGDPLVLER 49 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 18 ISNSCSPGDPLVLER 32 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 52 ISNSCSPGDPLVLER 66 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 90 ISNSCSPGDPLVLER 104 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 22 ISNSCSPGDPLVLER 36 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 5 ISNSCSPGDPLVLER 19 >SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 7 ISNSCSPGDPLVLER 21 >SB_13007| Best HMM Match : DUF1566 (HMM E-Value=6.2) Length = 157 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = -1 Query: 110 NTFFTALRQAFIFPRAEFLQPGGSTSSRA 24 N F+ Q EFLQPGGSTSSRA Sbjct: 19 NLFYECNLQKVTIDNIEFLQPGGSTSSRA 47 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 17 ISNSCSPGDPLVLER 31 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 6 ISNSCSPGDPLVLER 20 >SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 68 ISNSCSPGDPLVLER 82 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 34 ISNSCSPGDPLVLER 48 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 14 ISNSCSPGDPLVLER 28 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 27 ISNSCSPGDPLVLER 41 >SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 30 ISNSCSPGDPLVLER 44 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 26 ISNSCSPGDPLVLER 40 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = +1 Query: 25 ALELVDPPGCRNSARGKI 78 ALELVDPPGCRNS ++ Sbjct: 75 ALELVDPPGCRNSMDSRV 92 >SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 46 ISNSCSPGDPLVLER 60 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 32 ISNSCSPGDPLVLER 46 >SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 45 ISNSCSPGDPLVLER 59 >SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1295 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 591 ISNSCSPGDPLVLER 605 >SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 4 ISNSCSPGDPLVLER 18 >SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 12 ISNSCSPGDPLVLER 26 >SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 10 ISNSCSPGDPLVLER 24 >SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -2 Query: 67 VPNSCSPGDPLVLER 23 + NSCSPGDPLVLER Sbjct: 10 ISNSCSPGDPLVLER 24 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 33.1 bits (72), Expect = 0.23 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 25 ALELVDPPGCRNSAR 69 ALELVDPPGCRNS + Sbjct: 12 ALELVDPPGCRNSIK 26 >SB_31585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 33.1 bits (72), Expect = 0.23 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -1 Query: 89 RQAFIFPRAEFLQPGGSTSSRA 24 R FI EFLQPGGSTSSRA Sbjct: 16 RMRFIDYNIEFLQPGGSTSSRA 37 >SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 33.1 bits (72), Expect = 0.23 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 80 FIFPRAEFLQPGGSTSSRA 24 F F + EFLQPGGSTSSRA Sbjct: 25 FNFCKIEFLQPGGSTSSRA 43 >SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 181 Score = 33.1 bits (72), Expect = 0.23 Identities = 23/61 (37%), Positives = 34/61 (55%), Gaps = 3/61 (4%) Frame = -1 Query: 197 GADLPLAEHRRSLDIVPIFASEWVDNLLLNTFFTALRQA---FIFPRAEFLQPGGSTSSR 27 G+D ++H + + + + W + +N+ + LR A F F EFLQPGGSTSSR Sbjct: 16 GSDSLSSDH---VSVQGVVHTTWNELPCINSRYAGLRNAPEVFRFG-IEFLQPGGSTSSR 71 Query: 26 A 24 A Sbjct: 72 A 72 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 33.1 bits (72), Expect = 0.23 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +3 Query: 24 RSRTSGSPGLQEFGTR 71 RSRTSGSPGLQEF T+ Sbjct: 11 RSRTSGSPGLQEFDTK 26 >SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) Length = 126 Score = 33.1 bits (72), Expect = 0.23 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +3 Query: 24 RSRTSGSPGLQEFGTR 71 RSRTSGSPGLQEF T+ Sbjct: 11 RSRTSGSPGLQEFDTK 26 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 33.1 bits (72), Expect = 0.23 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 25 ALELVDPPGCRNSAR 69 ALELVDPPGCRNS + Sbjct: 12 ALELVDPPGCRNSIK 26 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 33.1 bits (72), Expect = 0.23 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +3 Query: 6 STAVAXRSRTSGSPGLQEF 62 ST+ RSRTSGSPGLQEF Sbjct: 100 STSGGGRSRTSGSPGLQEF 118 >SB_45832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 33.1 bits (72), Expect = 0.23 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -1 Query: 149 PIFASEWVDNLLLNTFFTALRQAFIFPRAEFLQPGGSTSSRA 24 P+ + W++ +++ +I EFLQPGGSTSSRA Sbjct: 2 PLNEALWINKECYEHYYSPAEINWIRFMIEFLQPGGSTSSRA 43 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 33.1 bits (72), Expect = 0.23 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 25 ALELVDPPGCRNSAR 69 ALELVDPPGCRNS + Sbjct: 12 ALELVDPPGCRNSIK 26 >SB_28253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 33.1 bits (72), Expect = 0.23 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = -1 Query: 92 LRQAFIFPRAEFLQPGGSTSSRA 24 +R I+ EFLQPGGSTSSRA Sbjct: 6 MRLKTIYKNIEFLQPGGSTSSRA 28 >SB_21182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 33.1 bits (72), Expect = 0.23 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 98 TALRQAFIFPRAEFLQPGGSTSSRA 24 TA R+A + EFLQPGGSTSSRA Sbjct: 3 TAFRRAVVI--IEFLQPGGSTSSRA 25 >SB_8705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 33.1 bits (72), Expect = 0.23 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 74 FPRAEFLQPGGSTSSRA 24 +P EFLQPGGSTSSRA Sbjct: 25 WPEIEFLQPGGSTSSRA 41 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 13 NSCSPGDPLVLER 25 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 11 NSCSPGDPLVLER 23 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 36 NSCSPGDPLVLER 48 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 4 NSCSPGDPLVLER 16 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 19 NSCSPGDPLVLER 31 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 28 NSCSPGDPLVLER 40 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 185 NSCSPGDPLVLER 197 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 80 NSCSPGDPLVLER 92 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 16 NSCSPGDPLVLER 28 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 8 NSCSPGDPLVLER 20 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 19 NSCSPGDPLVLER 31 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 28 NSCSPGDPLVLER 40 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 12 NSCSPGDPLVLER 24 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 8 NSCSPGDPLVLER 20 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 32.7 bits (71), Expect = 0.30 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -1 Query: 71 PRAEFLQPGGSTSSRA 24 P EFLQPGGSTSSRA Sbjct: 109 PNIEFLQPGGSTSSRA 124 >SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) Length = 171 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 25 ALELVDPPGCRNS 63 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 25 ALELVDPPGCRNS 63 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 5 NSCSPGDPLVLER 17 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 83 NSCSPGDPLVLER 95 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 3 NSCSPGDPLVLER 15 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 517 NSCSPGDPLVLER 529 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 383 NSCSPGDPLVLER 395 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 25 NSCSPGDPLVLER 37 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 15 NSCSPGDPLVLER 27 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 23 NSCSPGDPLVLER 35 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 32 NSCSPGDPLVLER 44 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 3 NSCSPGDPLVLER 15 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 23 NSCSPGDPLVLER 35 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 20 NSCSPGDPLVLER 32 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 4 NSCSPGDPLVLER 16 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 18 NSCSPGDPLVLER 30 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 8 NSCSPGDPLVLER 20 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 32.7 bits (71), Expect = 0.30 Identities = 17/27 (62%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = -1 Query: 101 FTALRQAFIFPRA-EFLQPGGSTSSRA 24 +T RQ + P EFLQPGGSTSSRA Sbjct: 64 YTQGRQGLLNPPCIEFLQPGGSTSSRA 90 >SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 25 ALELVDPPGCRNS 63 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 55 NSCSPGDPLVLER 67 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 5 NSCSPGDPLVLER 17 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 26 NSCSPGDPLVLER 38 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 12 NSCSPGDPLVLER 24 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.7 bits (71), Expect = 0.30 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -1 Query: 71 PRAEFLQPGGSTSSRA 24 P EFLQPGGSTSSRA Sbjct: 9 PNIEFLQPGGSTSSRA 24 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 12 NSCSPGDPLVLER 24 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 14 NSCSPGDPLVLER 26 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 164 NSCSPGDPLVLER 176 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 21 NSCSPGDPLVLER 33 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 22 NSCSPGDPLVLER 34 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 36 NSCSPGDPLVLER 48 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 19 NSCSPGDPLVLER 31 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 65 NSCSPGDPLVLER 77 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 9 NSCSPGDPLVLER 21 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 18 NSCSPGDPLVLER 30 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 6 NSCSPGDPLVLER 18 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 5 NSCSPGDPLVLER 17 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 12 NSCSPGDPLVLER 24 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 32.7 bits (71), Expect = 0.30 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 74 FPRAEFLQPGGSTSSRA 24 +P EFLQPGGSTSSRA Sbjct: 21 YPCIEFLQPGGSTSSRA 37 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 49 NSCSPGDPLVLER 61 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 25 ALELVDPPGCRNS 63 ALELVDPPGCRNS Sbjct: 12 ALELVDPPGCRNS 24 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 61 NSCSPGDPLVLER 23 NSCSPGDPLVLER Sbjct: 14 NSCSPGDPLVLER 26 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,690,865 Number of Sequences: 59808 Number of extensions: 500151 Number of successful extensions: 3671 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3669 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -