BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30221 (596 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 2.6 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 2.6 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 2.6 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 2.6 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 21 6.0 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 21 6.0 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.6 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 547 QRRYFE*VFISC*KCSLF 494 Q RYF +F+S KC LF Sbjct: 293 QSRYFIYMFVSVWKCLLF 310 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.6 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 547 QRRYFE*VFISC*KCSLF 494 Q RYF +F+S KC LF Sbjct: 293 QSRYFIYMFVSVWKCLLF 310 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.6 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 547 QRRYFE*VFISC*KCSLF 494 Q RYF +F+S KC LF Sbjct: 293 QSRYFIYMFVSVWKCLLF 310 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.6 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 547 QRRYFE*VFISC*KCSLF 494 Q RYF +F+S KC LF Sbjct: 293 QSRYFIYMFVSVWKCLLF 310 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 21.4 bits (43), Expect = 6.0 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +1 Query: 277 PRRSEVRGRTEPHRRRPESHR 339 PR ++ + R EP R RP R Sbjct: 318 PRATDHQRRNEPKRPRPNIDR 338 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 21.4 bits (43), Expect = 6.0 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = -1 Query: 104 RSSGSTRCVFNMWWTFRGLPHGTSLETRPR 15 +S GS++ FN +W + ++ +PR Sbjct: 438 QSQGSSKNTFNTFWQQSDVDLSRGMDFQPR 467 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,657 Number of Sequences: 336 Number of extensions: 2465 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -