BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30219 (698 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q6F0X8 Cluster: Putative uncharacterized protein; n=1; ... 36 0.72 >UniRef50_Q6F0X8 Cluster: Putative uncharacterized protein; n=1; Mesoplasma florum|Rep: Putative uncharacterized protein - Mesoplasma florum (Acholeplasma florum) Length = 159 Score = 36.3 bits (80), Expect = 0.72 Identities = 31/110 (28%), Positives = 47/110 (42%), Gaps = 4/110 (3%) Frame = +1 Query: 7 YDNYRKNKARVDARDT*TVNNKIKTPLRSNATNI-LQCYIEPINHITLTLAVKKKN*CNT 183 Y+ Y+KN V + V +K+ +N NI LQ + + + L+ + Sbjct: 51 YEKYKKNNDNVQKSEI--VKHKLPDSKNNNIDNIFLQNALSELEKLNSKLSFQNSKLRLR 108 Query: 184 SKEKRKKKSAAICHSLSTMTK---NRNSYCLIGLVPIITCQRD*NYCHRE 324 + K KKS I +LST+ K N I V IITC+ N+ E Sbjct: 109 EELKNNKKSGVIKENLSTLNKEIINLKKEIEITKVEIITCKNKINFLKGE 158 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 540,744,462 Number of Sequences: 1657284 Number of extensions: 8911126 Number of successful extensions: 19547 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 19101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19540 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 55371905986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -