BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30219 (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC23B6.02c |||sequence orphan|Schizosaccharomyces pombe|chr 3|... 25 7.9 >SPCC23B6.02c |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 139 Score = 25.4 bits (53), Expect = 7.9 Identities = 17/70 (24%), Positives = 33/70 (47%), Gaps = 1/70 (1%) Frame = +1 Query: 13 NYRKNKARVDARDT*TVNNKIKTPLRSN-ATNILQCYIEPINHITLTLAVKKKN*CNTSK 189 N+R++ D + + N+ K ++ A I + + ++ KKKN TSK Sbjct: 11 NFRRSDPAYDLDSSTAIENETKLSVKEKVAKEIANIALRSGGSESNGISKKKKNKKQTSK 70 Query: 190 EKRKKKSAAI 219 + + K +AA+ Sbjct: 71 KAKDKLAAAL 80 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,331,997 Number of Sequences: 5004 Number of extensions: 40353 Number of successful extensions: 76 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -