BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= wdS30219
(698 letters)
Database: rice
37,544 sequences; 14,793,348 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
06_01_0935 + 7216044-7216297,7216311-7216388,7216424-7216634 28 6.2
>06_01_0935 + 7216044-7216297,7216311-7216388,7216424-7216634
Length = 180
Score = 28.3 bits (60), Expect = 6.2
Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 3/65 (4%)
Frame = +1
Query: 70 KIKTPLRSNATNILQCYIEPINHITLTLAVKKKN*CNTSKE---KRKKKSAAICHSLSTM 240
KI +P+ S+ NIL H +K+ N+ KE K+K K A + HS S +
Sbjct: 85 KISSPVASSEANILSVAYSEAFH-----TLKRYKLLNSGKENVYKKKVKEADVVHSFSEI 139
Query: 241 TKNRN 255
+ +N
Sbjct: 140 AEYKN 144
Database: rice
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 14,793,348
Number of sequences in database: 37,544
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,795,145
Number of Sequences: 37544
Number of extensions: 223393
Number of successful extensions: 460
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 457
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 460
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1792053856
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -