BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30219 (698 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0935 + 7216044-7216297,7216311-7216388,7216424-7216634 28 6.2 >06_01_0935 + 7216044-7216297,7216311-7216388,7216424-7216634 Length = 180 Score = 28.3 bits (60), Expect = 6.2 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 3/65 (4%) Frame = +1 Query: 70 KIKTPLRSNATNILQCYIEPINHITLTLAVKKKN*CNTSKE---KRKKKSAAICHSLSTM 240 KI +P+ S+ NIL H +K+ N+ KE K+K K A + HS S + Sbjct: 85 KISSPVASSEANILSVAYSEAFH-----TLKRYKLLNSGKENVYKKKVKEADVVHSFSEI 139 Query: 241 TKNRN 255 + +N Sbjct: 140 AEYKN 144 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,795,145 Number of Sequences: 37544 Number of extensions: 223393 Number of successful extensions: 460 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 457 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 460 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -