BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30219 (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19689| Best HMM Match : VWA (HMM E-Value=0.0035) 31 0.68 SB_11428| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) 29 4.8 SB_4072| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_6033| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=1.6e-37) 28 8.4 SB_42540| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_19689| Best HMM Match : VWA (HMM E-Value=0.0035) Length = 885 Score = 31.5 bits (68), Expect = 0.68 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +1 Query: 520 FLKQWRIFLEASTKVTGADLLAIP 591 F+K+ RI+LE S K+ G D+L +P Sbjct: 152 FIKKMRIYLEISRKLNGPDVLCVP 175 >SB_11428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 521 Score = 29.5 bits (63), Expect = 2.7 Identities = 17/55 (30%), Positives = 30/55 (54%) Frame = -3 Query: 378 GFSTFELFGRIRNSKCGNLTMTIVLVALTGDYRDQTDETIGISVFRHCRKRMTNC 214 G TF+++ IR +K +L + +L + R + D+ + R CR+R+TNC Sbjct: 37 GTLTFDMWQNIR-AKLLSLAASRILKRESHPIRTRVDQDSPVENPRCCRRRITNC 90 >SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 88 RSNATNILQCYIEPINHITLTLAVK 162 R N+ NILQC + H TL++ +K Sbjct: 17 RRNSVNILQCMLSDSKHQTLSVVIK 41 >SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) Length = 411 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = +1 Query: 169 N*CNTSKEKRKKKSAAICHSLSTM--TKNRNSYCLIGLVPIITCQRD*NYCHRE 324 N +TS K K +I H+ + T+N+N C P + C R + C RE Sbjct: 74 NFSDTSSLKLLKTKGSIGHAFTVCIHTENQNQMCRPSQTPNLQCLRHGSVCKRE 127 >SB_4072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1364 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +1 Query: 13 NYRKNKARVDARDT*TVNNKIKTPLRSNATNILQCYIEPIN 135 NY KN+A D + + ++ +R N ++ Y+ PIN Sbjct: 136 NYHKNRAEDDPMNRWCAHVRVAVAMRINYPKMIYYYLSPIN 176 >SB_6033| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=1.6e-37) Length = 1052 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 13 NYRKNKARVDARDT*TVNNKIKTPLRSNATNILQCYIEPIN 135 NYRKN+AR D + + + R N ++ Y+ PIN Sbjct: 164 NYRKNRARDDPMNRWCAHVREAVAKRINYPEKIKYYLSPIN 204 >SB_42540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1471 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 495 SED*MFSKFFKTMAYISGSVD*SDRC*FVSDSSD 596 S+D + +T+ Y+ GS SD C F++DS D Sbjct: 1039 SQDSSHDEGLQTVGYVCGSRPLSDLCLFIADSVD 1072 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,848,696 Number of Sequences: 59808 Number of extensions: 286980 Number of successful extensions: 683 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 682 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -