BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30219 (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g29450.1 68417.m04204 leucine-rich repeat protein kinase, put... 31 0.97 At2g43590.1 68415.m05417 chitinase, putative similar to basic en... 28 5.2 At3g47540.1 68416.m05170 chitinase, putative similar to basic en... 28 6.8 >At4g29450.1 68417.m04204 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 863 Score = 30.7 bits (66), Expect = 0.97 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +1 Query: 145 LTLAVKKKN*CNTSKEKRKKKSAAI 219 LTL+ ++N CN+ +EK+KKKS + Sbjct: 490 LTLSADEQNLCNSCQEKKKKKSMVV 514 >At2g43590.1 68415.m05417 chitinase, putative similar to basic endochitinase CHB4 precursor SP:Q06209 from [Brassica napus] Length = 264 Score = 28.3 bits (60), Expect = 5.2 Identities = 17/49 (34%), Positives = 22/49 (44%) Frame = +1 Query: 532 WRIFLEASTKVTGADLLAIPRMPETCGRQNTLG*EGGMGFWLFSIRSPL 678 W A + G DLL R PE G T+ G+ FW+ S+R L Sbjct: 171 WNYNYGACGQSLGLDLL---RQPELVGSNPTVAFRTGLWFWMNSVRPVL 216 >At3g47540.1 68416.m05170 chitinase, putative similar to basic endochitinase CHB4 precursor SP:Q06209 from [Brassica napus] Length = 214 Score = 27.9 bits (59), Expect = 6.8 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +1 Query: 568 GADLLAIPRMPETCGRQNTLG*EGGMGFWLFSIRSPL 678 G DLL R PE G T+ G+ FW+ S+R L Sbjct: 133 GLDLL---RQPELVGSNPTVAFRKGLSFWINSVRPVL 166 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,773,800 Number of Sequences: 28952 Number of extensions: 198591 Number of successful extensions: 470 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 470 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -