BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30218 (701 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC428.02c |eca39|SPBC582.12c|branched chain amino acid aminotr... 28 1.1 SPAC343.09 |ubx3|mug39|UBX domain protein Ubx3|Schizosaccharomyc... 27 2.0 SPAC23C11.01 |||ER membrane protein, ICE2 family|Schizosaccharom... 27 3.4 SPAC3A12.04c |||RNase P and RNase MRP subunit p30 |Schizosacchar... 26 6.0 SPBC3E7.08c |rad13||DNA repair nuclease Rad13|Schizosaccharomyce... 25 7.9 SPAC26A3.15c |nsp1||nucleoporin Nsp1|Schizosaccharomyces pombe|c... 25 7.9 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 25 7.9 >SPBC428.02c |eca39|SPBC582.12c|branched chain amino acid aminotransferase Eca39|Schizosaccharomyces pombe|chr 2|||Manual Length = 380 Score = 28.3 bits (60), Expect = 1.1 Identities = 12/30 (40%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +2 Query: 149 INNWNSNQAWSVPNI--FGGVALQPLSQMF 232 I WN + WS P I FG + P S +F Sbjct: 47 IMKWNREKGWSTPEIVPFGKLCFHPASSVF 76 >SPAC343.09 |ubx3|mug39|UBX domain protein Ubx3|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 27.5 bits (58), Expect = 2.0 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +2 Query: 512 PSESNPPTETKPEQP 556 P NPPTE++PE+P Sbjct: 197 PPRENPPTESQPEKP 211 >SPAC23C11.01 |||ER membrane protein, ICE2 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 441 Score = 26.6 bits (56), Expect = 3.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 Query: 682 THFRNLLASLDY*LLFGFFL 623 THFRN+LA L GFFL Sbjct: 50 THFRNMLAMFGNFLSLGFFL 69 >SPAC3A12.04c |||RNase P and RNase MRP subunit p30 |Schizosaccharomyces pombe|chr 1|||Manual Length = 235 Score = 25.8 bits (54), Expect = 6.0 Identities = 10/43 (23%), Positives = 26/43 (60%) Frame = +1 Query: 415 SYNQIGLVLSLLRNPLKRPVRPESRVPLQTLQTI*VKSAH*NK 543 +Y G + ++++NP+ + + PE ++ + + T+ ++S NK Sbjct: 37 NYQYDGKLQNVIKNPIVKELYPEQKIKIYSRITLTIESMPQNK 79 >SPBC3E7.08c |rad13||DNA repair nuclease Rad13|Schizosaccharomyces pombe|chr 2|||Manual Length = 1112 Score = 25.4 bits (53), Expect = 7.9 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +1 Query: 538 NKTRTTRSRAIKTNFREQPSSARHRRSSLKKIQTTVNNPVKP 663 NK T + A N R+ PSS S +K + N +KP Sbjct: 125 NKKATALANASVQNERQMPSSMTLDNSEIKPVLNQRKNYLKP 166 >SPAC26A3.15c |nsp1||nucleoporin Nsp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 598 Score = 25.4 bits (53), Expect = 7.9 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +3 Query: 444 STEKPAEATSTTGVASAAPDIANH 515 +T KP E TSTT A++AP ++N+ Sbjct: 337 NTSKPTENTSTT--ATSAPPLSNN 358 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 25.4 bits (53), Expect = 7.9 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +1 Query: 148 NQQLELEPSMEC-SKYFWRSSTAAPQSDVQ 234 N+ +P C S+ +W +STA P+S VQ Sbjct: 1359 NESFSAKPVEPCASEKWWLNSTAVPKSVVQ 1388 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,883,543 Number of Sequences: 5004 Number of extensions: 59195 Number of successful extensions: 183 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 179 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 183 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 325165428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -