BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30216 (659 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 2.9 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 2.9 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 22 5.1 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 21 9.0 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 21 9.0 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 22.6 bits (46), Expect = 2.9 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Frame = +2 Query: 188 RQIHARSYP*GCS*APHPRGEGPKRLFE----GNALLRRLVRIGVLDEKQ 325 RQ+H + YP S A RG+ KR + GN++ + R G+ + Q Sbjct: 536 RQLHMQLYPDWSSRANATRGKKRKRKQDPADGGNSMKKCRARYGLDQQNQ 585 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 22.6 bits (46), Expect = 2.9 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Frame = +2 Query: 188 RQIHARSYP*GCS*APHPRGEGPKRLFE----GNALLRRLVRIGVLDEKQ 325 RQ+H + YP S A RG+ KR + GN++ + R G+ + Q Sbjct: 428 RQLHMQLYPDWSSRANATRGKKRKRKQDPADGGNSMKKCRARYGLDQQNQ 477 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.8 bits (44), Expect = 5.1 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = +1 Query: 367 LGASSADAGVQSWPGEVHPSCQNF 438 L A GV+ + VH C NF Sbjct: 289 LSGLKAPPGVEHFEDVVHKKCSNF 312 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 Query: 457 LCPQASCEHPIIYC 498 L P S +PIIYC Sbjct: 295 LAPLNSAANPIIYC 308 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = +1 Query: 388 AGVQSWPGEVHPSCQNFDPAKAYLCPQAS 474 AG+ SWP E + + + CP+ + Sbjct: 148 AGICSWPDEAKKKGCSSEEVFQFECPKVN 176 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,950 Number of Sequences: 336 Number of extensions: 3466 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -