BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30216 (659 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46749| Best HMM Match : No HMM Matches (HMM E-Value=.) 156 1e-38 SB_25666| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_53825| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_15605| Best HMM Match : p450 (HMM E-Value=1.4013e-45) 29 4.4 SB_44630| Best HMM Match : HECT (HMM E-Value=0) 28 5.9 SB_30413| Best HMM Match : WSC (HMM E-Value=2.4) 28 7.7 SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) 28 7.7 >SB_46749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 156 bits (379), Expect = 1e-38 Identities = 74/85 (87%), Positives = 81/85 (95%) Frame = +2 Query: 254 PKRLFEGNALLRRLVRIGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGLAKSIHHAR 433 P+RLFEGNALLRRLVRIGVLDE + KLDYVLGL+IEDFLERRLQTQVFK GLAKSIHHAR Sbjct: 65 PRRLFEGNALLRRLVRIGVLDESRKKLDYVLGLRIEDFLERRLQTQVFKLGLAKSIHHAR 124 Query: 434 ILIRQRHICVRKQVVNIPSFIVRLD 508 +LIRQRHI VRKQ+VN+PSF+VRLD Sbjct: 125 VLIRQRHIRVRKQLVNVPSFVVRLD 149 Score = 118 bits (283), Expect = 6e-27 Identities = 56/62 (90%), Positives = 58/62 (93%) Frame = +3 Query: 75 VFSKTYVTPRRPFEKARLDQELKIIGEYGLRNKREVWRVKYTLARIRKAARELLTLEEKD 254 V SKTY TPRRPFEK RL+QELKIIGEYGLRNKREVWRVK TLA+IRKAARELLTLEEKD Sbjct: 5 VCSKTYTTPRRPFEKERLNQELKIIGEYGLRNKREVWRVKLTLAKIRKAARELLTLEEKD 64 Query: 255 PR 260 PR Sbjct: 65 PR 66 Score = 64.1 bits (149), Expect = 1e-10 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 514 KHIDFSLKSPFGGGRPGRVKRKNLRKGQGG 603 KHIDFSL SP+GGGRPGRVKRKN++KGQGG Sbjct: 152 KHIDFSLNSPYGGGRPGRVKRKNMKKGQGG 181 >SB_25666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.5 bits (73), Expect = 0.16 Identities = 20/61 (32%), Positives = 30/61 (49%) Frame = +3 Query: 102 RRPFEKARLDQELKIIGEYGLRNKREVWRVKYTLARIRKAARELLTLEEKDPRDCSKVMP 281 +RP K L Q+ +G+YG KR+ V AARE+L +E P+ S V+ Sbjct: 57 KRPLGKELLSQQFSDVGKYGRIYKRKFPTVNIVDIADPSAAREVLGIETLGPKFDSPVLE 116 Query: 282 F 284 + Sbjct: 117 Y 117 >SB_53825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 33.1 bits (72), Expect = 0.21 Identities = 22/91 (24%), Positives = 42/91 (46%) Frame = +2 Query: 254 PKRLFEGNALLRRLVRIGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGLAKSIHHAR 433 P R+ +L +L +G++ K+ L + F RRL + +A+ + A Sbjct: 69 PYRVEATEQILEKLHNMGLISTKK-NLGQCNKVNASSFCRRRLPVVMVNLKMAQVVKDAV 127 Query: 434 ILIRQRHICVRKQVVNIPSFIVRLDLASTLT 526 I Q H+ V +V+ P+F+V ++ +T Sbjct: 128 KYIEQGHVRVGPEVIMDPAFLVAKNMEDFVT 158 >SB_15605| Best HMM Match : p450 (HMM E-Value=1.4013e-45) Length = 454 Score = 28.7 bits (61), Expect = 4.4 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +3 Query: 117 KARLDQELKIIGEYGLRNKREVWRVKYTLARIRKAARELLTLEEKDPRDCSKVMPF 284 K L Q+ +G+YG KR+ V AARE+L +E P+ S V+ + Sbjct: 2 KELLSQQFSDVGKYGRIYKRKFPTVNIVDIADPSAAREVLGIETLGPKFDSPVLEY 57 >SB_44630| Best HMM Match : HECT (HMM E-Value=0) Length = 1003 Score = 28.3 bits (60), Expect = 5.9 Identities = 20/60 (33%), Positives = 27/60 (45%) Frame = -2 Query: 193 LTRHTSRLLRRPYSPMIFNSWSRRAFSKGRRGVTYVFENTDGTLLFTILASSHALLADKN 14 LTRH+S+ R P I S S RR + N+ T+ AS+ A L+D N Sbjct: 40 LTRHSSQPKLRRDEPSITGSLSNLTLDNSRRAASLAQLNSLKATGKTLSASNLAALSDTN 99 >SB_30413| Best HMM Match : WSC (HMM E-Value=2.4) Length = 259 Score = 27.9 bits (59), Expect = 7.7 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -1 Query: 482 CSQLACGHKYAFAGSKFWHDGWTSP 408 C++LA Y++ G +FW + W+ P Sbjct: 72 CARLAEQKNYSYFGVQFWGECWSGP 96 >SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) Length = 884 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = +2 Query: 293 LVRIGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGLAKSIHHARIL 439 L++I D+K M+ +Y+LGL +E +R +++ + K H R L Sbjct: 806 LLQILTQDDKNMEAEYLLGLILERQGKRLEAMKLYMDVIRKDTSHVRAL 854 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,922,744 Number of Sequences: 59808 Number of extensions: 449140 Number of successful extensions: 1179 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1075 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1176 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -