BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30216 (659 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 23 2.0 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 2.6 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 23 2.6 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 2.6 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 2.6 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 23 3.4 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 23 3.4 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 23 3.4 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 22 4.5 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 6.0 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 6.0 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 7.9 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 7.9 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 7.9 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 7.9 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 7.9 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 7.9 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 7.9 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 7.9 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 7.9 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 7.9 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 7.9 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 7.9 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 7.9 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 7.9 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 21 7.9 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 7.9 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.4 bits (48), Expect = 2.0 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +2 Query: 245 GEGPKRLFEGNALLRRLVRIGVLDEKQMKLDYVLGLKIE 361 GEG K LFE + L +I ++E+ D VL + IE Sbjct: 167 GEGSKPLFEREEIKNVLTKINKIEEQ----DTVLVVNIE 201 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -2 Query: 136 SWSRRAFSKGRRGVTYVFENTDGTL 62 S++ + S + +TYV++N +GTL Sbjct: 201 SFAIESISYEQTAITYVWKNDEGTL 225 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -2 Query: 136 SWSRRAFSKGRRGVTYVFENTDGTL 62 S++ + S + +TYV++N +GTL Sbjct: 201 SFAIESISYEQTAITYVWKNDEGTL 225 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -2 Query: 136 SWSRRAFSKGRRGVTYVFENTDGTL 62 S++ + S + +TYV++N +GTL Sbjct: 252 SFAIESISYEQTAITYVWKNDEGTL 276 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -2 Query: 136 SWSRRAFSKGRRGVTYVFENTDGTL 62 S++ + S + +TYV++N +GTL Sbjct: 201 SFAIESISYEQTAITYVWKNDEGTL 225 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.6 bits (46), Expect = 3.4 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +2 Query: 245 GEGPKRLFEGNALLRRLVRIGVLDEKQMKLDYVLGLKIE 361 GEG K LFE + L +I ++E D VL + IE Sbjct: 156 GEGSKPLFEREEIKNVLTKINKIEEH----DTVLVVNIE 190 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.6 bits (46), Expect = 3.4 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +2 Query: 245 GEGPKRLFEGNALLRRLVRIGVLDEKQMKLDYVLGLKIE 361 GEG K LFE + L +I ++E D VL + IE Sbjct: 167 GEGSKPLFEREEIKNVLTKINKIEEH----DTVLVVNIE 201 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.6 bits (46), Expect = 3.4 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +2 Query: 245 GEGPKRLFEGNALLRRLVRIGVLDEKQMKLDYVLGLKIE 361 GEG K LFE + L +I ++E D VL + IE Sbjct: 156 GEGSKPLFEREEIKNVLTKINKIEEH----DTVLVVNIE 190 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +2 Query: 245 GEGPKRLFEGNALLRRLVRIGVLDE 319 GEG K LFE + L +I ++E Sbjct: 167 GEGSKPLFEREEIKNVLTKINKIEE 191 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.8 bits (44), Expect = 6.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 597 LSLAEVLPLDTSRTTSTEW 541 LSL V+ LDT++ EW Sbjct: 10 LSLVSVVLLDTTQEEKLEW 28 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.8 bits (44), Expect = 6.0 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Query: 245 GEGPKRLFEGNALLRRLVRIGVLDEKQMKLDYVLGLKIE 361 GEG K +FE + L +I ++E D VL + IE Sbjct: 167 GEGSKPIFEREEIKNVLTKINKIEEH----DTVLVVNIE 201 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 Query: 537 FQREVNVLARSRRTINDGMFTT 472 FQ A +R +N GMFTT Sbjct: 121 FQTFYKTAAWARLRMNSGMFTT 142 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 Query: 537 FQREVNVLARSRRTINDGMFTT 472 FQ A +R +N GMFTT Sbjct: 121 FQTFYKTAAWARLRMNSGMFTT 142 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -2 Query: 373 LQEVLNLQTKHIIEFHLFFIQYSNTNQ 293 ++ V N+ K + F L F+Q N N+ Sbjct: 42 IRPVQNMTEKVHVNFGLAFVQLINVNE 68 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 245 GEGPKRLFEGNALLRRLVRIGVLDE 319 GEG K +FE + L +I ++E Sbjct: 156 GEGSKPIFEREEIKNVLTKINKIEE 180 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 245 GEGPKRLFEGNALLRRLVRIGVLDE 319 GEG K +FE + L +I ++E Sbjct: 156 GEGSKPIFEREEIKNVLTKINKIEE 180 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 245 GEGPKRLFEGNALLRRLVRIGVLDE 319 GEG K +FE + L +I ++E Sbjct: 167 GEGSKPIFEREEIKNVLTKINKIEE 191 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 245 GEGPKRLFEGNALLRRLVRIGVLDE 319 GEG K +FE + L +I ++E Sbjct: 167 GEGSKPIFEREEIKNVLTKINKIEE 191 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 245 GEGPKRLFEGNALLRRLVRIGVLDE 319 GEG K +FE + L +I ++E Sbjct: 167 GEGSKPIFEREEIKNVLTKINKIEE 191 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 245 GEGPKRLFEGNALLRRLVRIGVLDE 319 GEG K +FE + L +I ++E Sbjct: 167 GEGSKPIFEREEIKNVLTKINKIEE 191 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 245 GEGPKRLFEGNALLRRLVRIGVLDE 319 GEG K +FE + L +I ++E Sbjct: 167 GEGSKPIFEREEIKNVLTKINKIEE 191 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 245 GEGPKRLFEGNALLRRLVRIGVLDE 319 GEG K +FE + L +I ++E Sbjct: 167 GEGSKPIFEREEIKNVLTKINKIEE 191 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 245 GEGPKRLFEGNALLRRLVRIGVLDE 319 GEG K +FE + L +I ++E Sbjct: 156 GEGSKPIFEREEIKNVLTKINKIEE 180 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 245 GEGPKRLFEGNALLRRLVRIGVLDE 319 GEG K +FE + L +I ++E Sbjct: 167 GEGSKPIFEREEIKNVLTKINKIEE 191 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 245 GEGPKRLFEGNALLRRLVRIGVLDE 319 GEG K +FE + L +I ++E Sbjct: 167 GEGSKPIFEREEIKNVLTKINKIEE 191 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 245 GEGPKRLFEGNALLRRLVRIGVLDE 319 GEG K +FE + L +I ++E Sbjct: 167 GEGSKPIFEREEIKNVLTKINKIEE 191 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 245 GEGPKRLFEGNALLRRLVRIGVLDE 319 GEG K +FE + L +I ++E Sbjct: 167 GEGSKPIFEREEIKNVLTKINKIEE 191 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,466 Number of Sequences: 438 Number of extensions: 4078 Number of successful extensions: 30 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19855845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -