BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30215 (712 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. 31 0.036 DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. 29 0.19 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 28 0.33 AY341219-1|AAR13783.1| 200|Anopheles gambiae SRPN10 protein. 27 0.77 AY341217-1|AAR13781.1| 200|Anopheles gambiae SRPN10 protein. 27 0.77 AY341216-1|AAR13780.1| 200|Anopheles gambiae SRPN10 protein. 27 0.77 AY341215-1|AAR13779.1| 200|Anopheles gambiae SRPN10 protein. 27 0.77 AJ420785-4|CAD12784.1| 395|Anopheles gambiae serpin protein. 27 0.77 AJ420785-3|CAD12783.1| 380|Anopheles gambiae serpin protein. 27 0.77 AJ420785-2|CAD12782.1| 382|Anopheles gambiae serpin protein. 27 0.77 AJ420785-1|CAD12781.1| 379|Anopheles gambiae serpin protein. 27 0.77 AJ271353-1|CAB69785.1| 380|Anopheles gambiae putative serine pr... 27 0.77 AJ271352-1|CAB69784.1| 379|Anopheles gambiae putative serine pr... 27 0.77 AY341218-1|AAR13782.1| 200|Anopheles gambiae SRPN10 protein. 26 1.0 AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. 23 7.2 AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. 23 7.2 AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. 23 7.2 AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. 23 7.2 AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. 23 7.2 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 23 9.5 >DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. Length = 418 Score = 31.1 bits (67), Expect = 0.036 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +3 Query: 540 FGINIFKQITSSQPGNMVVSPFSIHDIIGLFFNKGAT 650 F ++ K++ PGN V+SP S+ ++ L + A+ Sbjct: 48 FDWSVIKEVLHKAPGNAVISPLSVKALLALLYEGSAS 84 >DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. Length = 409 Score = 28.7 bits (61), Expect = 0.19 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +3 Query: 540 FGINIFKQITSSQPGNMVVSPFSIHDIIGLFFNKGATGF 656 F + K+I + N+V+SPFS+ ++ L + T F Sbjct: 37 FDLMFVKEIFKNHNSNVVLSPFSVKILLTLIYEASDTSF 75 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 27.9 bits (59), Expect = 0.33 Identities = 18/58 (31%), Positives = 28/58 (48%) Frame = +2 Query: 296 SNLNGLTIGTKIPIINPNFGAPQYSPYANNVIIQPSIQTYNQETTKIVPQKSGTPAKK 469 SN G T+ T P+I GAP P ++++ + + T +I P + PAKK Sbjct: 1061 SNAGG-TVSTTNPVIG---GAPALLPTTRTLLLKRPLVSARYGTPRIGPAPAVEPAKK 1114 >AY341219-1|AAR13783.1| 200|Anopheles gambiae SRPN10 protein. Length = 200 Score = 26.6 bits (56), Expect = 0.77 Identities = 14/48 (29%), Positives = 30/48 (62%), Gaps = 2/48 (4%) Frame = +3 Query: 492 ASNTTRIDSVDYAITH-FGINIFKQITSSQPG-NMVVSPFSIHDIIGL 629 A N++ +D+ + ++ F ++++I++ G N+V+SPFSI + L Sbjct: 47 ADNSSSLDAQFVSQSNSFATKLYQRISAKHAGENVVISPFSISACLSL 94 >AY341217-1|AAR13781.1| 200|Anopheles gambiae SRPN10 protein. Length = 200 Score = 26.6 bits (56), Expect = 0.77 Identities = 14/48 (29%), Positives = 30/48 (62%), Gaps = 2/48 (4%) Frame = +3 Query: 492 ASNTTRIDSVDYAITH-FGINIFKQITSSQPG-NMVVSPFSIHDIIGL 629 A N++ +D+ + ++ F ++++I++ G N+V+SPFSI + L Sbjct: 47 ADNSSSLDAQFVSQSNSFATKLYQRISAKHAGENVVISPFSISACLSL 94 >AY341216-1|AAR13780.1| 200|Anopheles gambiae SRPN10 protein. Length = 200 Score = 26.6 bits (56), Expect = 0.77 Identities = 14/48 (29%), Positives = 30/48 (62%), Gaps = 2/48 (4%) Frame = +3 Query: 492 ASNTTRIDSVDYAITH-FGINIFKQITSSQPG-NMVVSPFSIHDIIGL 629 A N++ +D+ + ++ F ++++I++ G N+V+SPFSI + L Sbjct: 47 ADNSSSLDAQFVSQSNSFATKLYQRISAKHAGENVVISPFSISACLSL 94 >AY341215-1|AAR13779.1| 200|Anopheles gambiae SRPN10 protein. Length = 200 Score = 26.6 bits (56), Expect = 0.77 Identities = 14/48 (29%), Positives = 30/48 (62%), Gaps = 2/48 (4%) Frame = +3 Query: 492 ASNTTRIDSVDYAITH-FGINIFKQITSSQPG-NMVVSPFSIHDIIGL 629 A N++ +D+ + ++ F ++++I++ G N+V+SPFSI + L Sbjct: 47 ADNSSSLDAQFVSQSNSFATKLYQRISAKHAGENVVISPFSISACLSL 94 >AJ420785-4|CAD12784.1| 395|Anopheles gambiae serpin protein. Length = 395 Score = 26.6 bits (56), Expect = 0.77 Identities = 14/48 (29%), Positives = 30/48 (62%), Gaps = 2/48 (4%) Frame = +3 Query: 492 ASNTTRIDSVDYAITH-FGINIFKQITSSQPG-NMVVSPFSIHDIIGL 629 A N++ +D+ + ++ F ++++I++ G N+V+SPFSI + L Sbjct: 2 ADNSSSLDAQFVSQSNSFATKLYQRISAKHAGENVVISPFSISACLSL 49 >AJ420785-3|CAD12783.1| 380|Anopheles gambiae serpin protein. Length = 380 Score = 26.6 bits (56), Expect = 0.77 Identities = 14/48 (29%), Positives = 30/48 (62%), Gaps = 2/48 (4%) Frame = +3 Query: 492 ASNTTRIDSVDYAITH-FGINIFKQITSSQPG-NMVVSPFSIHDIIGL 629 A N++ +D+ + ++ F ++++I++ G N+V+SPFSI + L Sbjct: 2 ADNSSSLDAQFVSQSNSFATKLYQRISAKHAGENVVISPFSISACLSL 49 >AJ420785-2|CAD12782.1| 382|Anopheles gambiae serpin protein. Length = 382 Score = 26.6 bits (56), Expect = 0.77 Identities = 14/48 (29%), Positives = 30/48 (62%), Gaps = 2/48 (4%) Frame = +3 Query: 492 ASNTTRIDSVDYAITH-FGINIFKQITSSQPG-NMVVSPFSIHDIIGL 629 A N++ +D+ + ++ F ++++I++ G N+V+SPFSI + L Sbjct: 2 ADNSSSLDAQFVSQSNSFATKLYQRISAKHAGENVVISPFSISACLSL 49 >AJ420785-1|CAD12781.1| 379|Anopheles gambiae serpin protein. Length = 379 Score = 26.6 bits (56), Expect = 0.77 Identities = 14/48 (29%), Positives = 30/48 (62%), Gaps = 2/48 (4%) Frame = +3 Query: 492 ASNTTRIDSVDYAITH-FGINIFKQITSSQPG-NMVVSPFSIHDIIGL 629 A N++ +D+ + ++ F ++++I++ G N+V+SPFSI + L Sbjct: 2 ADNSSSLDAQFVSQSNSFATKLYQRISAKHAGENVVISPFSISACLSL 49 >AJ271353-1|CAB69785.1| 380|Anopheles gambiae putative serine protease inhibitor protein. Length = 380 Score = 26.6 bits (56), Expect = 0.77 Identities = 14/48 (29%), Positives = 30/48 (62%), Gaps = 2/48 (4%) Frame = +3 Query: 492 ASNTTRIDSVDYAITH-FGINIFKQITSSQPG-NMVVSPFSIHDIIGL 629 A N++ +D+ + ++ F ++++I++ G N+V+SPFSI + L Sbjct: 2 ADNSSSLDAQFVSQSNSFATKLYQRISAKHAGENVVISPFSISACLSL 49 >AJ271352-1|CAB69784.1| 379|Anopheles gambiae putative serine protease inhibitor protein. Length = 379 Score = 26.6 bits (56), Expect = 0.77 Identities = 14/48 (29%), Positives = 30/48 (62%), Gaps = 2/48 (4%) Frame = +3 Query: 492 ASNTTRIDSVDYAITH-FGINIFKQITSSQPG-NMVVSPFSIHDIIGL 629 A N++ +D+ + ++ F ++++I++ G N+V+SPFSI + L Sbjct: 2 ADNSSSLDAQFVSQSNSFATKLYQRISAKHAGENVVISPFSISACLSL 49 >AY341218-1|AAR13782.1| 200|Anopheles gambiae SRPN10 protein. Length = 200 Score = 26.2 bits (55), Expect = 1.0 Identities = 13/48 (27%), Positives = 30/48 (62%), Gaps = 2/48 (4%) Frame = +3 Query: 492 ASNTTRIDSVDYAITH-FGINIFKQITSSQPG-NMVVSPFSIHDIIGL 629 A N++ +D+ + ++ F +++++++ G N+V+SPFSI + L Sbjct: 47 ADNSSSLDAQFVSQSNSFATKLYQRVSAKHAGENVVISPFSISACLSL 94 >AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.4 bits (48), Expect = 7.2 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 170 RGFTKQLPDTESVSQIRFH 226 RGF +PDT + FH Sbjct: 31 RGFRASIPDTPGLQMFAFH 49 >AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.4 bits (48), Expect = 7.2 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 170 RGFTKQLPDTESVSQIRFH 226 RGF +PDT + FH Sbjct: 31 RGFRASIPDTPGLQMFAFH 49 >AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.4 bits (48), Expect = 7.2 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 170 RGFTKQLPDTESVSQIRFH 226 RGF +PDT + FH Sbjct: 31 RGFRASIPDTPGLQMFAFH 49 >AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. Length = 187 Score = 23.4 bits (48), Expect = 7.2 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 170 RGFTKQLPDTESVSQIRFH 226 RGF +PDT + FH Sbjct: 31 RGFRASIPDTPGLQMFAFH 49 >AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.4 bits (48), Expect = 7.2 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 170 RGFTKQLPDTESVSQIRFH 226 RGF +PDT + FH Sbjct: 31 RGFRASIPDTPGLQMFAFH 49 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +2 Query: 593 GISILHSRHYWALLQQGRYRVPTLDQIQWQ 682 G +L S +W +QQ R+ ++ Q W+ Sbjct: 989 GSRLLESAEWWDRIQQAARRILSVLQEDWR 1018 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 736,765 Number of Sequences: 2352 Number of extensions: 14890 Number of successful extensions: 36 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72758970 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -