BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30215 (712 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 29 0.043 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 21 8.7 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 8.7 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 29.1 bits (62), Expect = 0.043 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 7/44 (15%) Frame = +2 Query: 356 APQYSPYANNVIIQPSIQTYNQ-------ETTKIVPQKSGTPAK 466 +PQY +++++ QPSI+TY Q +T +I PQ+ T +K Sbjct: 439 SPQYPSTSSHILQQPSIRTYTQQQFPYVHDTLQIQPQEQLTLSK 482 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 588 MVVSPFSIHDIIGLFFN 638 M +SP IHD LFF+ Sbjct: 378 MALSPVDIHDDRTLFFH 394 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.4 bits (43), Expect = 8.7 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = -1 Query: 694 RMPKLPLNLIQSGNPVAPLLKKSPIMS*MENGDTTMLP 581 R+ + P+ S NPV+P+ P+ + +T +LP Sbjct: 428 RVERDPILTPPSSNPVSPVPSPDPLDLAIPVRETLILP 465 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,190 Number of Sequences: 438 Number of extensions: 4585 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -