BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30210 (584 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 26 1.0 DQ396550-1|ABD60145.1| 113|Anopheles gambiae adipokinetic hormo... 25 1.4 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 24 3.2 AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 23 5.5 AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein ... 23 5.5 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 25.8 bits (54), Expect = 1.0 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = +3 Query: 285 SPVHHRGAPFKLSNDARSEQWQKTDGRTYCQTCV*NYSLVNWRK 416 S VH R F +SND S W D V + L W K Sbjct: 57 SEVHKRNNFFAVSNDDASYPWAVYDDGLLAVRKVKGFVLYRWNK 100 >DQ396550-1|ABD60145.1| 113|Anopheles gambiae adipokinetic hormone II protein. Length = 113 Score = 25.4 bits (53), Expect = 1.4 Identities = 14/51 (27%), Positives = 22/51 (43%) Frame = +3 Query: 141 LKSSFSADGVATMCKSLICLCRTTFPLKRSTQNIYLIQWQVCTQAFP*SPV 293 + S S+ +A L+ LC P+ + Q + W +A P SPV Sbjct: 1 MNSISSSRHLAAKLFLLVALCAVLLPVPSAGQVTFSRDWNAGKRAMPDSPV 51 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 4/31 (12%) Frame = +2 Query: 68 WNDDVAEAGSVVVETM--SLPQAAD--IPEI 148 W++D AEAG+ V E + ++P+A +PE+ Sbjct: 640 WDNDDAEAGAAVPEAVLDAIPEAMPEAVPEV 670 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 23.4 bits (48), Expect = 5.5 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 21 NFYLVIEKYQSWPRRTGM 74 +F V+ WPRRTGM Sbjct: 104 DFEKVLRSEGPWPRRTGM 121 >AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein S26 protein. Length = 114 Score = 23.4 bits (48), Expect = 5.5 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = -3 Query: 303 HDGALGFTETLVCIPATE*GKYFAYFSLTEM*SCRDISETCTS*QLHLPK 154 H A+ T C+P + K F ++ E + RDIS+ LPK Sbjct: 16 HVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISDASVYSSYVLPK 65 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 660,461 Number of Sequences: 2352 Number of extensions: 13975 Number of successful extensions: 39 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55927431 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -