BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30210 (584 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 3.9 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 22 3.9 M29491-1|AAA27726.1| 79|Apis mellifera protein ( Bee homeobox-... 22 5.1 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 22 5.1 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 8.9 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.2 bits (45), Expect = 3.9 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 523 SPLRRSSTKANLGFCAQV 576 +PL S ++AN GFCA + Sbjct: 151 NPLDDSISQANEGFCAVI 168 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 22.2 bits (45), Expect = 3.9 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 523 SPLRRSSTKANLGFCAQV 576 +PL S ++AN GFCA + Sbjct: 146 NPLDDSISQANEGFCAVI 163 >M29491-1|AAA27726.1| 79|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H17. ). Length = 79 Score = 21.8 bits (44), Expect = 5.1 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = +1 Query: 118 FTTSRRHS*NQAFRQMELLRCASL*YVSAGLHFR*REVRKIFTSFSGRYAHKRFRKAQ 291 FTT + S + FR+ + L A S+ LH +V+ F + R KR ++A+ Sbjct: 16 FTTQQLLSLEKKFREKQYLTIAERAEFSSSLHLTETQVKIWFQ--NRRAKAKRLQEAE 71 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 21.8 bits (44), Expect = 5.1 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -1 Query: 200 ETYQRLAHRSNSICRKA*FQECRRLVVKTWFP 105 + Y+RL H N I ++ F RL T+ P Sbjct: 240 QVYRRLVHAVNEIEKRLLFSHNDRLGFLTFCP 271 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.0 bits (42), Expect = 8.9 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = +2 Query: 29 FSNRKVPIMAEENWN 73 F N+K+P+ E W+ Sbjct: 550 FKNKKLPVFLAEIWD 564 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,406 Number of Sequences: 438 Number of extensions: 3620 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16993167 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -