BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30207 (550 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.3 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 22 4.1 DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory pro... 21 9.4 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 2.3 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -2 Query: 72 WGRLKFFFCFDGVFHDPNK 16 WG+ + F C G+ D NK Sbjct: 1299 WGKYEVFNCAPGLHWDNNK 1317 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 21.8 bits (44), Expect = 4.1 Identities = 17/58 (29%), Positives = 24/58 (41%) Frame = +2 Query: 71 QPKMANTDLTRLLKSDEIRKVLRAPNKRVIRATRKLNPLTNNKAMLKLNPYAAVLKRK 244 Q KM N +S + + P K VI++ R L P ++L N KRK Sbjct: 15 QNKMYNVIQHSPQQSIIVSGSITQPTKTVIQSKRPLAPAPERTSVLVTNNSDLRCKRK 72 >DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory protein 11 protein. Length = 127 Score = 20.6 bits (41), Expect = 9.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 77 KMANTDLTRLLKSDEIRK 130 K N DL ++KSD + K Sbjct: 27 KYDNVDLDEIIKSDRLLK 44 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,651 Number of Sequences: 336 Number of extensions: 1461 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13516233 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -