BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30207 (550 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF000196-2|AAC24253.1| 345|Caenorhabditis elegans Ribosomal pro... 69 2e-12 Z99267-1|CAB16465.1| 732|Caenorhabditis elegans C33A12.12 protein. 28 3.9 Z68493-14|CAA92801.1| 732|Caenorhabditis elegans Hypothetical p... 28 3.9 AL033537-1|CAA22147.1| 732|Caenorhabditis elegans Hypothetical ... 28 3.9 >AF000196-2|AAC24253.1| 345|Caenorhabditis elegans Ribosomal protein, large subunitprotein 4 protein. Length = 345 Score = 68.9 bits (161), Expect = 2e-12 Identities = 31/80 (38%), Positives = 52/80 (65%), Gaps = 1/80 (1%) Frame = +2 Query: 5 RLDPLFGSWKTPSKQ-KKNFNLPQPKMANTDLTRLLKSDEIRKVLRAPNKRVIRATRKLN 181 +LD ++G+ S Q KK +++P P MAN+D +R+++S+E+ K +RAP K + N Sbjct: 258 KLDTIYGTTVANSSQLKKGWSVPLPIMANSDFSRIIRSEEVVKAIRAPKKNPVLPKVHRN 317 Query: 182 PLTNNKAMLKLNPYAAVLKR 241 PL + KLNPYA++L++ Sbjct: 318 PLKKRTLLYKLNPYASILRK 337 >Z99267-1|CAB16465.1| 732|Caenorhabditis elegans C33A12.12 protein. Length = 732 Score = 28.3 bits (60), Expect = 3.9 Identities = 16/52 (30%), Positives = 29/52 (55%) Frame = +2 Query: 89 TDLTRLLKSDEIRKVLRAPNKRVIRATRKLNPLTNNKAMLKLNPYAAVLKRK 244 T++ LLK DEIR++ N R I+ + LN +++M ++ +L R+ Sbjct: 551 TNIAILLKYDEIREIFTDENSRTIK--QMLNKFDVSRSMHVISLLTLILSRE 600 >Z68493-14|CAA92801.1| 732|Caenorhabditis elegans Hypothetical protein C33A12.12 protein. Length = 732 Score = 28.3 bits (60), Expect = 3.9 Identities = 16/52 (30%), Positives = 29/52 (55%) Frame = +2 Query: 89 TDLTRLLKSDEIRKVLRAPNKRVIRATRKLNPLTNNKAMLKLNPYAAVLKRK 244 T++ LLK DEIR++ N R I+ + LN +++M ++ +L R+ Sbjct: 551 TNIAILLKYDEIREIFTDENSRTIK--QMLNKFDVSRSMHVISLLTLILSRE 600 >AL033537-1|CAA22147.1| 732|Caenorhabditis elegans Hypothetical protein C33A12.12 protein. Length = 732 Score = 28.3 bits (60), Expect = 3.9 Identities = 16/52 (30%), Positives = 29/52 (55%) Frame = +2 Query: 89 TDLTRLLKSDEIRKVLRAPNKRVIRATRKLNPLTNNKAMLKLNPYAAVLKRK 244 T++ LLK DEIR++ N R I+ + LN +++M ++ +L R+ Sbjct: 551 TNIAILLKYDEIREIFTDENSRTIK--QMLNKFDVSRSMHVISLLTLILSRE 600 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,069,313 Number of Sequences: 27780 Number of extensions: 148605 Number of successful extensions: 465 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 442 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 465 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1113119490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -