BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30206 (705 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 29 0.11 AY748839-1|AAV28187.1| 169|Anopheles gambiae cytochrome P450 pr... 25 3.1 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 24 5.4 AJ304410-1|CAC67443.1| 190|Anopheles gambiae calpain protein. 23 7.1 AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 pr... 23 9.4 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 29.5 bits (63), Expect = 0.11 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -1 Query: 411 TRFRDGSQIVHQIGLGHTNTGIDDRKSALVLVG 313 T+ R+GS I HQ N + DR+ +L+L G Sbjct: 55 TQNRNGSPINHQGNAASANVAVADRQQSLILAG 87 >AY748839-1|AAV28187.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 24.6 bits (51), Expect = 3.1 Identities = 21/81 (25%), Positives = 30/81 (37%) Frame = -1 Query: 549 RIARRHCV*SEQSRVSDQVTGVEANTELSNHADVGTCLKSLHESFSTRFRDGSQIVHQIG 370 R+ V R D+V G L + + +L E+ S I H++ Sbjct: 18 RLLHNPPVIERMQREIDEVVGHGRLPTLDDRTQLAYTEATLREAMRIDTLVPSGIAHRVQ 77 Query: 369 LGHTNTGIDDRKSALVLVGND 307 T G D K LVL+G D Sbjct: 78 EDTTLRGYDLPKDTLVLIGLD 98 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.8 bits (49), Expect = 5.4 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -3 Query: 106 CLHFFRHFLYCFLFNSHKMTRGFLTHVFQS 17 C F HF Y F F+S F +F S Sbjct: 945 CFRLFNHFYYLFDFDS--SLNSFRNRIFSS 972 >AJ304410-1|CAC67443.1| 190|Anopheles gambiae calpain protein. Length = 190 Score = 23.4 bits (48), Expect = 7.1 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = +3 Query: 306 DHSQQERGHSYDHRYRYWYDQGRFGEQF 389 D +QE G ++DH +W F F Sbjct: 34 DEQKQELGLNFDHDGEFWMSYRDFTRYF 61 >AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 protein. Length = 509 Score = 23.0 bits (47), Expect = 9.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 Query: 631 DESLYPRPRGSPLSG 587 D +Y PR PLSG Sbjct: 106 DRGMYSNPRADPLSG 120 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 768,528 Number of Sequences: 2352 Number of extensions: 18108 Number of successful extensions: 40 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -