BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30202 (830 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI00004D87F9 Cluster: UPI00004D87F9 related cluster; n... 38 0.23 UniRef50_Q8JKV9 Cluster: Histone h3, h4; n=2; root|Rep: Histone ... 33 6.6 >UniRef50_UPI00004D87F9 Cluster: UPI00004D87F9 related cluster; n=3; Xenopus tropicalis|Rep: UPI00004D87F9 UniRef100 entry - Xenopus tropicalis Length = 547 Score = 38.3 bits (85), Expect = 0.23 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = -2 Query: 670 IGYIILYFLLFKYWITYFFLQLFKFMVFYYIVISVSDS 557 + Y+IL+ LL +WI +F LF++ +FY + + S S Sbjct: 94 LSYLILHLLLHLFWILHFLPHLFRYFIFYLLSLDTSFS 131 >UniRef50_Q8JKV9 Cluster: Histone h3, h4; n=2; root|Rep: Histone h3, h4 - Heliothis zea virus 1 Length = 1111 Score = 33.5 bits (73), Expect = 6.6 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -1 Query: 815 KPKGPGPKSIPNGKVPTNVLNMPVIDILKVGTTPKPPKYG 696 KPK P PKS P PTN N V I K TTP+ G Sbjct: 625 KPK-PNPKSKPPTNTPTNTPNQNVTIIFKQPTTPRVDSNG 663 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 759,689,442 Number of Sequences: 1657284 Number of extensions: 15115632 Number of successful extensions: 33054 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 31167 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32919 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 72143915536 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -