BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30202 (830 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U43195-1|AAB02814.1| 1354|Homo sapiens Rho-associated, coiled-co... 31 5.1 BC113114-1|AAI13115.1| 1354|Homo sapiens Rho-associated, coiled-... 31 5.1 BC041849-1|AAH41849.1| 118|Homo sapiens ROCK1 protein protein. 31 5.1 >U43195-1|AAB02814.1| 1354|Homo sapiens Rho-associated, coiled-coil containing protein kinase p160ROCK protein. Length = 1354 Score = 31.1 bits (67), Expect = 5.1 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 259 KSQHDVTPSQGMYLLNISEESQSHWYGHLISNV 161 K +DVT ++ M LL S++ Q W HL+ + Sbjct: 1284 KVSYDVTSARDMLLLACSQDEQKKWVTHLVKKI 1316 >BC113114-1|AAI13115.1| 1354|Homo sapiens Rho-associated, coiled-coil containing protein kinase 1 protein. Length = 1354 Score = 31.1 bits (67), Expect = 5.1 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 259 KSQHDVTPSQGMYLLNISEESQSHWYGHLISNV 161 K +DVT ++ M LL S++ Q W HL+ + Sbjct: 1284 KVSYDVTSARDMLLLACSQDEQKKWVTHLVKKI 1316 >BC041849-1|AAH41849.1| 118|Homo sapiens ROCK1 protein protein. Length = 118 Score = 31.1 bits (67), Expect = 5.1 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 259 KSQHDVTPSQGMYLLNISEESQSHWYGHLISNV 161 K +DVT ++ M LL S++ Q W HL+ + Sbjct: 73 KVSYDVTSARDMLLLACSQDEQKKWVTHLVKKI 105 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,368,746 Number of Sequences: 237096 Number of extensions: 2244577 Number of successful extensions: 3778 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3649 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3778 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10426655866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -