BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30202 (830 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 26 0.37 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 22 8.0 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 26.2 bits (55), Expect = 0.37 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 750 HIKHVCGDLSVWYGFGPGAFRLSP 821 H VC + Y F PGAF LSP Sbjct: 465 HKVEVCEKTIIPYEFDPGAFLLSP 488 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.8 bits (44), Expect = 8.0 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +3 Query: 471 YSLALNNKKVTC*RANGSDTSVLGDLLSQL 560 + L N TC NG T ++ D+L+ + Sbjct: 14 WELNATNSPHTCRTKNGDYTKIMPDILTAI 43 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 225,723 Number of Sequences: 438 Number of extensions: 5246 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26581563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -