BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30197 (850 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC025333-1|AAH25333.1| 74|Homo sapiens DAND5 protein protein. 30 9.2 AK127721-1|BAC87100.1| 733|Homo sapiens protein ( Homo sapiens ... 30 9.2 >BC025333-1|AAH25333.1| 74|Homo sapiens DAND5 protein protein. Length = 74 Score = 30.3 bits (65), Expect = 9.2 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = -3 Query: 647 GSPGGVVAWKAANAEGNCSG*ETASQSSRDLPLTPDQAYSKS*HNHTQSTFP 492 G PGG KA + EG+ + +TA ++ DL +PD+ + H + +P Sbjct: 16 GYPGGAKRLKAGS-EGSDATHQTAGSTASDLEPSPDRQTGRQTHGQADAPWP 66 >AK127721-1|BAC87100.1| 733|Homo sapiens protein ( Homo sapiens cDNA FLJ45821 fis, clone NT2RP8001584. ). Length = 733 Score = 30.3 bits (65), Expect = 9.2 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +2 Query: 590 HYSFPRRLLPSMLRPHQGTPSAAMHHATH 676 H++ P +P + PH TP HH H Sbjct: 626 HHTTPHCTIPHHISPHHSTPHHTTHHTPH 654 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,165,211 Number of Sequences: 237096 Number of extensions: 2650202 Number of successful extensions: 8689 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8689 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10761200974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -