BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30195 (596 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81050-6|CAB02856.1| 713|Caenorhabditis elegans Hypothetical pr... 33 0.12 L16685-6|ABD63199.1| 1047|Caenorhabditis elegans Trp (transient ... 33 0.20 L16685-5|AAA28167.3| 1027|Caenorhabditis elegans Trp (transient ... 33 0.20 AJ276027-1|CAC81654.1| 1027|Caenorhabditis elegans TRP homologou... 33 0.20 Z75542-3|CAA99860.1| 359|Caenorhabditis elegans Hypothetical pr... 29 1.9 Z81543-5|CAB04427.2| 507|Caenorhabditis elegans Hypothetical pr... 28 4.4 >Z81050-6|CAB02856.1| 713|Caenorhabditis elegans Hypothetical protein C50B6.7 protein. Length = 713 Score = 33.5 bits (73), Expect = 0.12 Identities = 13/40 (32%), Positives = 26/40 (65%) Frame = +1 Query: 31 QVPTYEVLDKRDTLDEFKILFNKIKKIGVRVIVDLIPNYV 150 Q +Y++ + EF+ + N+ K+GVR+IVD++ N++ Sbjct: 85 QPVSYKLDSRSGNEQEFQDMVNRCNKVGVRIIVDIVMNHM 124 >L16685-6|ABD63199.1| 1047|Caenorhabditis elegans Trp (transient receptor potential)channel family protein 1, isoform b protein. Length = 1047 Score = 32.7 bits (71), Expect = 0.20 Identities = 20/54 (37%), Positives = 25/54 (46%), Gaps = 4/54 (7%) Frame = +3 Query: 228 DNLSNWGSKSTRQRLHEAINVRSSTCISSVTTALILTSV----IPKLLRSSTWA 377 DN+ W SK + RL AI +S +LTS+ IP RS TWA Sbjct: 320 DNIDVWASKLSLSRLKLAIKYEQKAFVSHPHCQQLLTSIWYEGIPYRQRSGTWA 373 >L16685-5|AAA28167.3| 1027|Caenorhabditis elegans Trp (transient receptor potential)channel family protein 1, isoform a protein. Length = 1027 Score = 32.7 bits (71), Expect = 0.20 Identities = 20/54 (37%), Positives = 25/54 (46%), Gaps = 4/54 (7%) Frame = +3 Query: 228 DNLSNWGSKSTRQRLHEAINVRSSTCISSVTTALILTSV----IPKLLRSSTWA 377 DN+ W SK + RL AI +S +LTS+ IP RS TWA Sbjct: 300 DNIDVWASKLSLSRLKLAIKYEQKAFVSHPHCQQLLTSIWYEGIPYRQRSGTWA 353 >AJ276027-1|CAC81654.1| 1027|Caenorhabditis elegans TRP homologous cation channel proteinprotein. Length = 1027 Score = 32.7 bits (71), Expect = 0.20 Identities = 20/54 (37%), Positives = 25/54 (46%), Gaps = 4/54 (7%) Frame = +3 Query: 228 DNLSNWGSKSTRQRLHEAINVRSSTCISSVTTALILTSV----IPKLLRSSTWA 377 DN+ W SK + RL AI +S +LTS+ IP RS TWA Sbjct: 300 DNIDVWASKLSLSRLKLAIKYEQKAFVSHPHCQQLLTSIWYEGIPYRQRSGTWA 353 >Z75542-3|CAA99860.1| 359|Caenorhabditis elegans Hypothetical protein F55D12.3 protein. Length = 359 Score = 29.5 bits (63), Expect = 1.9 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = +2 Query: 305 HQFCDNCADLNFGNPKVVEKFDMGPKACDWCPVLVGSELITR--VNCSSN 448 H FCD C +FG F+ G +C+ C + L TR + CS N Sbjct: 12 HSFCDICGKKSFG-------FNYGAHSCNACKMFFRRALSTRKILQCSKN 54 >Z81543-5|CAB04427.2| 507|Caenorhabditis elegans Hypothetical protein F49B2.5 protein. Length = 507 Score = 28.3 bits (60), Expect = 4.4 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -2 Query: 373 HVELLNNFGI-TEVKISAVVTELMQVELLTFIASCKRWRVDFEPQLDRLS 227 H +LL+ + + T + +VTELMQ LLTF+ +R R PQL +S Sbjct: 292 HPKLLSLYAVCTRDEPILIVTELMQENLLTFLQ--RRGRQCQMPQLVEIS 339 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,693,097 Number of Sequences: 27780 Number of extensions: 290401 Number of successful extensions: 930 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 889 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 930 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1268802960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -