BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30190 (536 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 24 1.1 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 21 8.0 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 8.0 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 23.8 bits (49), Expect = 1.1 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = -3 Query: 417 SYFTIVSKCHTVSRSVHNPTELQSIVVLAIVDEEQDVVFV 298 S T+V C S + T++ S+++ ++ QD+VF+ Sbjct: 124 SKLTLVLSCAMKFESYPHDTQICSMMIESLSHTTQDLVFI 163 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +2 Query: 134 NLWENNRVYFKIHNTKYNQYLKL 202 N NN + +N YN Y KL Sbjct: 95 NYNNNNYNNYNYNNNNYNNYKKL 117 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +2 Query: 428 PLGXKPPNLLWSYTF*TIRGNASCL 502 P G P N+ WSY + G++ L Sbjct: 608 PTGDLPLNIRWSYPGEEMGGSSGVL 632 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,646 Number of Sequences: 438 Number of extensions: 2919 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15213684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -