BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30189 (821 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18253| Best HMM Match : ADAM_spacer1 (HMM E-Value=4e-05) 29 4.6 SB_11387| Best HMM Match : MFS_1 (HMM E-Value=4.4e-06) 28 8.0 >SB_18253| Best HMM Match : ADAM_spacer1 (HMM E-Value=4e-05) Length = 339 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -1 Query: 266 GIWWL-YVLNDQSHGVHAQHGPYPYCGVHDVRPSSTGL 156 G+W +VL D G+ A HGPYP C + D+ +T + Sbjct: 104 GLWDRGHVLRDT--GLDAGHGPYPGCKMFDLPAGATNV 139 >SB_11387| Best HMM Match : MFS_1 (HMM E-Value=4.4e-06) Length = 815 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -3 Query: 690 WEHFFSSHMEGIGWNNWWSICCTKYWQ-TPLSGGAT 586 W F +EG+ + WS C T TP+SG AT Sbjct: 479 WLAFPLEFLEGLTYGTSWSTCVTYMADATPMSGAAT 514 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,517,417 Number of Sequences: 59808 Number of extensions: 704840 Number of successful extensions: 2474 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2259 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2464 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2299585728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -