BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30185 (783 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 26 1.5 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 25 3.5 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 25 3.5 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 25 3.5 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 25 3.5 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 25 3.5 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 25 3.5 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 25 3.5 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 25 3.5 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 25 3.5 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 25 3.5 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 25 3.5 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 25 3.5 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 25 3.5 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 25 3.5 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 25 3.5 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 25 3.5 AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. 24 4.6 CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase ... 24 6.1 AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 24 6.1 DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. 23 8.1 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 23 8.1 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -2 Query: 656 PPPSTLERAPERNDHKVPTGGNLPGSQLFPP 564 PPP ++AP D P G PG Q+ P Sbjct: 164 PPPIAHQQAPFAMDPARPNPGMPPGPQMMRP 194 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 3.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 434 LFFYQSGHRYRVGAMNLPM*IN 499 LF Y HR+RVGA L + +N Sbjct: 351 LFAYADTHRHRVGANYLMLPVN 372 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 3.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 434 LFFYQSGHRYRVGAMNLPM*IN 499 LF Y HR+RVGA L + +N Sbjct: 351 LFAYADTHRHRVGANYLMLPVN 372 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 3.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 434 LFFYQSGHRYRVGAMNLPM*IN 499 LF Y HR+RVGA L + +N Sbjct: 351 LFAYADTHRHRVGANYLMLPVN 372 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 3.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 434 LFFYQSGHRYRVGAMNLPM*IN 499 LF Y HR+RVGA L + +N Sbjct: 351 LFAYADTHRHRVGANYLMLPVN 372 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 3.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 434 LFFYQSGHRYRVGAMNLPM*IN 499 LF Y HR+RVGA L + +N Sbjct: 351 LFAYADTHRHRVGANYLMLPVN 372 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 3.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 434 LFFYQSGHRYRVGAMNLPM*IN 499 LF Y HR+RVGA L + +N Sbjct: 351 LFAYADTHRHRVGANYLMLPVN 372 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 3.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 434 LFFYQSGHRYRVGAMNLPM*IN 499 LF Y HR+RVGA L + +N Sbjct: 351 LFAYADTHRHRVGANYLMLPVN 372 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 3.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 434 LFFYQSGHRYRVGAMNLPM*IN 499 LF Y HR+RVGA L + +N Sbjct: 351 LFAYADTHRHRVGANYLMLPVN 372 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 3.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 434 LFFYQSGHRYRVGAMNLPM*IN 499 LF Y HR+RVGA L + +N Sbjct: 351 LFAYADTHRHRVGANYLMLPVN 372 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 3.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 434 LFFYQSGHRYRVGAMNLPM*IN 499 LF Y HR+RVGA L + +N Sbjct: 351 LFAYADTHRHRVGANYLMLPVN 372 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 3.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 434 LFFYQSGHRYRVGAMNLPM*IN 499 LF Y HR+RVGA L + +N Sbjct: 351 LFAYADTHRHRVGANYLMLPVN 372 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 3.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 434 LFFYQSGHRYRVGAMNLPM*IN 499 LF Y HR+RVGA L + +N Sbjct: 351 LFAYADTHRHRVGANYLMLPVN 372 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 24.6 bits (51), Expect = 3.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 434 LFFYQSGHRYRVGAMNLPM*IN 499 LF Y HR+RVGA L + +N Sbjct: 351 LFAYADTHRHRVGANYLMLPVN 372 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 24.6 bits (51), Expect = 3.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 434 LFFYQSGHRYRVGAMNLPM*IN 499 LF Y HR+RVGA L + +N Sbjct: 335 LFAYADTHRHRVGANYLMLPVN 356 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 24.6 bits (51), Expect = 3.5 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -2 Query: 668 FFIIPPPSTLERAPERNDHKVPTGGNLP 585 F+ P ER + N HK+P G LP Sbjct: 440 FYPDPDRFDPERFNDENKHKIPLGAYLP 467 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 24.6 bits (51), Expect = 3.5 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 7/42 (16%) Frame = +2 Query: 353 EASGLPKNTSAVV-------NCAGQQFHLGGEKPLFFYQSGH 457 E++G P ++SA++ NC G +F L K +FF+ H Sbjct: 454 ESAGAPVDSSAMLAFGLGPRNCIGSRFALMETKAVFFFLLTH 495 >AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. Length = 304 Score = 24.2 bits (50), Expect = 4.6 Identities = 8/30 (26%), Positives = 17/30 (56%) Frame = +3 Query: 162 FCKSKCLIIDKILLCFTFIINILKQCGGTG 251 +CK C + D+ + ++I+ ++ GG G Sbjct: 208 YCKGSCHLADRFSSEYHYVIDQYRRQGGAG 237 >CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase protein. Length = 573 Score = 23.8 bits (49), Expect = 6.1 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +1 Query: 535 SSSTGLSCLNGGKSWLPGRFPPVGTL*SFRSGA-RSRVDGGGMIKNHG 675 + S GL C +P PPVG+L FR+ R+R G NHG Sbjct: 50 TESCGLFCTYYSFKGIPYAEPPVGSL-RFRNPVPRARWTGVRDGSNHG 96 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 23.8 bits (49), Expect = 6.1 Identities = 18/69 (26%), Positives = 27/69 (39%) Frame = -2 Query: 650 PSTLERAPERNDHKVPTGGNLPGSQLFPPFKQLRPVEEENLPPVVGLPHPY*FTLEGS*H 471 P T P+ ++P + +P Q P + LP V HPY F G Sbjct: 391 PGTKHVIPKDTFIQIPVYALHRDPEFYPEPDQFNP--DRFLPEEVKKRHPYVFLPFGEGP 448 Query: 470 QLCTCVRTG 444 ++C +R G Sbjct: 449 RICIGLRFG 457 >DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. Length = 383 Score = 23.4 bits (48), Expect = 8.1 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = +2 Query: 215 YYQHTETMWRHR 250 +Y+HTE +W+ R Sbjct: 135 FYEHTEELWKDR 146 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 350 LLTRIYFSRLAYELRSLYHILLMKAVR 270 LL + FSRL Y H+L++K R Sbjct: 753 LLADVAFSRLRYNAAIWAHVLVLKENR 779 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 959,438 Number of Sequences: 2352 Number of extensions: 24545 Number of successful extensions: 99 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 99 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81913191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -