BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30183 (488 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4350| Best HMM Match : L15 (HMM E-Value=3.9e-10) 59 2e-09 SB_3035| Best HMM Match : PAN (HMM E-Value=2.9e-08) 32 0.29 SB_50276| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_26471| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 >SB_4350| Best HMM Match : L15 (HMM E-Value=3.9e-10) Length = 173 Score = 59.3 bits (137), Expect = 2e-09 Identities = 24/44 (54%), Positives = 33/44 (75%) Frame = +2 Query: 125 RINMDKYHPGYFGKLGMRNFHFRKNKNFCPVLNLDKLWTLVSER 256 R + + HPGYFGK+GMR+FH +N P +NLDK+W+LVSE+ Sbjct: 67 RGSYEAIHPGYFGKVGMRHFHLTRNAYHKPSINLDKVWSLVSEQ 110 Score = 38.3 bits (85), Expect = 0.003 Identities = 19/39 (48%), Positives = 22/39 (56%) Frame = +1 Query: 256 TRLKYASAPDGKVPVINIVKAXXXXXXXXXXXPKQPVIV 372 TR Y + DG VPVI++VKA PKQPVIV Sbjct: 111 TRQNYKNKKDGPVPVIDVVKAGYYKVLGKGLLPKQPVIV 149 >SB_3035| Best HMM Match : PAN (HMM E-Value=2.9e-08) Length = 240 Score = 31.9 bits (69), Expect = 0.29 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = -1 Query: 209 RNSCSF*SGNFSYQVCQSIQDGTCPC*FCDGAHHQHYHDLLDAYGA 72 R+SC + F +C+S T PC D H +H DL+D GA Sbjct: 52 RSSCQ--ARCFMNNLCRSYNYNTTPCQLSDSDHLEHPSDLVDKPGA 95 >SB_50276| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1048 Score = 28.3 bits (60), Expect = 3.6 Identities = 11/46 (23%), Positives = 22/46 (47%) Frame = -1 Query: 248 RLMSKAYLSSKLDRNSCSF*SGNFSYQVCQSIQDGTCPC*FCDGAH 111 R++ K YL ++ C + + +C+ +G+C CD +H Sbjct: 85 RVILKTYLCVSYEQGFCKSGNSCTRWHICKGFLEGSCTGTHCDKSH 130 >SB_26471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 566 Score = 27.1 bits (57), Expect = 8.3 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = +1 Query: 133 HGQVPSWILWQTWY 174 +G+ SW++W+TW+ Sbjct: 342 YGEFSSWLVWRTWF 355 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,065,734 Number of Sequences: 59808 Number of extensions: 260215 Number of successful extensions: 578 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 518 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 578 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1038380485 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -