BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30183 (488 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 4.0 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 21 5.3 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 7.0 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.8 bits (44), Expect = 4.0 Identities = 14/48 (29%), Positives = 19/48 (39%) Frame = -1 Query: 263 SLVVQRLMSKAYLSSKLDRNSCSF*SGNFSYQVCQSIQDGTCPC*FCD 120 S+VV +YL KL+RN + Q +C C CD Sbjct: 287 SVVVSDYSDYSYLDEKLERNDLDL--EKYEGISSTPSQASSCSCLDCD 332 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 21.4 bits (43), Expect = 5.3 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 252 NDEAEVCICSRWQGPRHQYCQSWIL*VARQRQTPQT 359 +DEAE S+ G + QS I VAR+ +T T Sbjct: 272 SDEAEPSSTSKKSGIVRSHQQSCINRVARETKTAGT 307 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.0 bits (42), Expect = 7.0 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = +3 Query: 297 RHQYCQSWIL*VARQRQTPQTTCHSKS 377 RH ++W+ R + TPQ+ S++ Sbjct: 241 RHLERKAWVASFGRPKMTPQSLLPSQT 267 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,511 Number of Sequences: 438 Number of extensions: 2678 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13421061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -