BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30175 (663 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g27190.1 68415.m03268 iron(III)-zinc(II) purple acid phosphat... 30 1.2 At1g30860.1 68414.m03774 expressed protein 28 4.8 At1g25450.1 68414.m03160 very-long-chain fatty acid condensing e... 27 8.4 >At2g27190.1 68415.m03268 iron(III)-zinc(II) purple acid phosphatase (PAP12) identical to iron(III)-zinc(II) purple acid phosphatase [precursor] SP:Q38924 from [Arabidopsis thaliana] Length = 469 Score = 30.3 bits (65), Expect = 1.2 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +3 Query: 558 LPDRKPLNTPIFWIPPEEGTPIYIHI 635 LPD PL++ +F +PP +P +H+ Sbjct: 40 LPDDMPLDSDVFEVPPGHNSPQQVHV 65 >At1g30860.1 68414.m03774 expressed protein Length = 730 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 Query: 603 AGSKKWGYLKVSDLVNNIVNSPQPKTGSDN 514 +G KWG +V+DL+ + N + +T DN Sbjct: 147 SGESKWG--RVADLIRRLSNEDKKRTAGDN 174 >At1g25450.1 68414.m03160 very-long-chain fatty acid condensing enzyme, putative nearly identical to fatty acid condensing enzyme CUT1 GI:5001734 from [Arabidopsis thaliana] Length = 492 Score = 27.5 bits (58), Expect = 8.4 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = +1 Query: 211 KILTPTPLPYIINFKRIVENGA--GTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 381 KI P PYI +FK+ E+ G V L N+ G V+ + +LH G +S Sbjct: 364 KIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTS 422 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,922,929 Number of Sequences: 28952 Number of extensions: 221679 Number of successful extensions: 446 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 441 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 446 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1393347168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -