BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30174 (805 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. 24 6.3 AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 pr... 23 8.3 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 8.3 >AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. Length = 93 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -3 Query: 419 CSSRPKHARNSSPARAIL*TRPQNFDMPP 333 C+S +SP+R IL TR + + PP Sbjct: 2 CTSCAWRCARASPSRPILTTRGRRWPRPP 30 >AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 protein. Length = 492 Score = 23.4 bits (48), Expect = 8.3 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +3 Query: 39 SQLRKVSKNKTKGKAFRTETTRTNPMMMALTSIASVP 149 S L++++K++ FRT P ++ LT I S+P Sbjct: 201 STLQRLTKSRKFMDNFRTSGVFICPGLLKLTRITSLP 237 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.4 bits (48), Expect = 8.3 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -2 Query: 249 DILSPFRYIKVAHPGPFKFI 190 D+ Y+K AH GPF+ + Sbjct: 825 DVRQLITYVKGAHGGPFRVV 844 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 755,543 Number of Sequences: 2352 Number of extensions: 13938 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84823812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -