BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30172 (728 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g45300.1 68416.m04891 isovaleryl-CoA-dehydrogenase (IVD) iden... 64 9e-11 At3g51840.1 68416.m05685 short-chain acyl-CoA oxidase identical ... 43 2e-04 At1g62530.1 68414.m07055 hypothetical protein 31 0.59 At3g20680.1 68416.m02617 expressed protein 29 2.4 At4g37950.1 68417.m05365 expressed protein 29 4.2 At5g53520.1 68418.m06651 oligopeptide transporter OPT family pro... 27 9.6 At5g17970.1 68418.m02108 disease resistance protein (TIR-NBS-LRR... 27 9.6 At3g21630.1 68416.m02728 protein kinase family protein contains ... 27 9.6 At1g65850.1 68414.m07472 disease resistance protein (TIR-NBS-LRR... 27 9.6 >At3g45300.1 68416.m04891 isovaleryl-CoA-dehydrogenase (IVD) identical to isovaleryl-CoA-dehydrogenase precursor [Arabidopsis thaliana] GI:5596622 Length = 409 Score = 64.1 bits (149), Expect = 9e-11 Identities = 27/59 (45%), Positives = 42/59 (71%) Frame = +1 Query: 88 ASEIANKAATDAVQVFGGNGFNTEYPVEKLMRDAKIYQIYEGTSQIQRLIISREILPQQ 264 A+E A + A A+Q GGNG+ EY +L+RDAK+Y+I GTS+I+R++I RE+ ++ Sbjct: 351 AAERATQVALQAIQCLGGNGYINEYATGRLLRDAKLYEIGAGTSEIRRIVIGRELFKEE 409 >At3g51840.1 68416.m05685 short-chain acyl-CoA oxidase identical to Short-chain acyl CoA oxidase [Arabidopsis thaliana] GI:5478795; contains InterPro entry IPR006089: Acyl-CoA dehydrogenase Length = 436 Score = 43.2 bits (97), Expect = 2e-04 Identities = 25/81 (30%), Positives = 38/81 (46%) Frame = +1 Query: 10 IAWQRAAWMVDHGQKNTVMASVAKCHASEIANKAATDAVQVFGGNGFNTEYPVEKLMRDA 189 + W R + + GQ AS+ K S A + A+ ++ GGNG ++ V K D Sbjct: 343 MGW-RLCKLYETGQMTPGQASLGKAWISSKARETASLGRELLGGNGILADFLVAKAFCDL 401 Query: 190 KIYQIYEGTSQIQRLIISREI 252 + YEGT I L+ RE+ Sbjct: 402 EPIYTYEGTYDINTLVTGREV 422 >At1g62530.1 68414.m07055 hypothetical protein Length = 282 Score = 31.5 bits (68), Expect = 0.59 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +3 Query: 366 ISYIETVFQSNEKKKQEYTTKNPQTKPNI 452 I+ +ETVF+S + KK + TK+ + KPN+ Sbjct: 238 INLLETVFRSRDYKKMQGKTKDGKCKPNL 266 >At3g20680.1 68416.m02617 expressed protein Length = 338 Score = 29.5 bits (63), Expect = 2.4 Identities = 18/48 (37%), Positives = 28/48 (58%) Frame = -3 Query: 240 YDEPLNLRGSFVDLVYLGVPHQFLDWVFGVEAVSSEHLHRISGCLVSD 97 +D P++ RGS V L++L F+D V+A S+ +H I+ VSD Sbjct: 137 HDLPISRRGSNVKLLFLWPNPSFID--PAVKAFRSDSIHHIAMSPVSD 182 >At4g37950.1 68417.m05365 expressed protein Length = 678 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 Query: 20 NAPHGWLTTDKRIQLWHQWPS 82 N HGW+++D+RI W PS Sbjct: 257 NKVHGWISSDQRIGFWMITPS 277 >At5g53520.1 68418.m06651 oligopeptide transporter OPT family protein similar to SP|P40900 Sexual differentiation process protein isp4 {Schizosaccharomyces pombe}, oligopeptide transporter Opt1p [Candida albicans] GI:2367386; contains Pfam profile PF03169: OPT oligopeptide transporter protein Length = 733 Score = 27.5 bits (58), Expect = 9.6 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 477 VIIFNMRNVYLVWFGGFLLCTLVFFF 400 + I+ + L W+G FL C + FF Sbjct: 430 ICIYYKTQIQLPWWGAFLACLIAIFF 455 >At5g17970.1 68418.m02108 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 780 Score = 27.5 bits (58), Expect = 9.6 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +1 Query: 148 FNTEYPVEKLMRDAKIYQIYEGTSQIQRL 234 F E+ VE MRD+K+ +++EG ++ L Sbjct: 611 FRPEFLVELTMRDSKLEKLWEGIQPLKSL 639 >At3g21630.1 68416.m02728 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 617 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +2 Query: 38 LTTDKRIQLWHQWPSVMLRKSLTRQPLMRCKCSEETAS 151 LTT + +Q + +P+ + S T L+ C C +E+ S Sbjct: 124 LTTMESLQARNPFPATNIPLSATLNVLVNCSCGDESVS 161 >At1g65850.1 68414.m07472 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1036 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +1 Query: 142 NGFNTEYPVEKLMRDAKIYQIYEGTSQIQRL 234 + F TEY VE MR +K+++++EG + L Sbjct: 628 SNFCTEYLVELNMRFSKLHKLWEGNRPLANL 658 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,989,382 Number of Sequences: 28952 Number of extensions: 329982 Number of successful extensions: 881 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 854 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 881 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1594686376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -