BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30171 (679 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 25 0.75 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 21 7.0 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 24.6 bits (51), Expect = 0.75 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = +1 Query: 196 FKT*ENSCCSKYFENDCSISNRVFLP-GNSLMI-NLQDPTFDDLSEKL 333 F T NSC S F N+ N F P NS++I N D + S ++ Sbjct: 382 FSTTANSCRSSTFRNNRDEYNVCFRPRNNSILIKNFNDSPESNRSNEI 429 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 21.4 bits (43), Expect = 7.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -3 Query: 392 AAGFRFSAHTLSASCYFFLVSFSDKSS 312 AAGF F A T FF ++++ SS Sbjct: 12 AAGFHFGAFTCEGCKSFFGRTYNNISS 38 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,665 Number of Sequences: 336 Number of extensions: 2258 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17697850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -