BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30169 (700 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK022935-1|BAB14316.1| 636|Homo sapiens protein ( Homo sapiens ... 35 0.32 Y15921-1|CAA75881.1| 144|Homo sapiens COL1A1 and PDGFB fusion t... 32 2.3 AF111169-4|AAD44364.1| 608|Homo sapiens unknown protein. 32 2.3 Y15918-1|CAA75878.1| 173|Homo sapiens COL1A1 and PDGFB fusion t... 31 5.2 AF211950-1|AAG10399.1| 397|Homo sapiens lim-homeobox transcript... 25 6.9 BC008965-1|AAH08965.2| 837|Homo sapiens BAZ2A protein protein. 30 6.9 AB002312-1|BAA20773.2| 1899|Homo sapiens KIAA0314 protein protein. 30 6.9 BC146791-1|AAI46792.1| 1858|Homo sapiens myosin XVI protein. 30 9.1 AL390918-1|CAI15821.1| 1858|Homo sapiens protein ( Human DNA seq... 30 9.1 AL353143-1|CAH73221.1| 1858|Homo sapiens protein ( Human DNA seq... 30 9.1 AL161431-1|CAI15548.1| 1858|Homo sapiens protein ( Human DNA seq... 30 9.1 AL157771-1|CAI16366.1| 1858|Homo sapiens protein ( Human DNA seq... 30 9.1 AL136132-1|CAH70519.1| 1858|Homo sapiens protein ( Human DNA seq... 30 9.1 AB020672-1|BAA74888.2| 1900|Homo sapiens KIAA0865 protein protein. 30 9.1 >AK022935-1|BAB14316.1| 636|Homo sapiens protein ( Homo sapiens cDNA FLJ12873 fis, clone NT2RP2003764. ). Length = 636 Score = 34.7 bits (76), Expect = 0.32 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +2 Query: 329 PLSNPPLWPYTMYFRMPHRCHGNLQSCPTQRGQKGSPP 442 P+ +P WP + + P RCHG L + QR Q GS P Sbjct: 592 PVEHPQEWPQGIRVQPPLRCHGPLCAVWIQRLQAGSSP 629 >Y15921-1|CAA75881.1| 144|Homo sapiens COL1A1 and PDGFB fusion transcript protein. Length = 144 Score = 31.9 bits (69), Expect = 2.3 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +1 Query: 379 PPMPRKPSELPNPKGAKGVPPPQRIWEMVMNELDRRED 492 P P P LP P GA G P P+ ++EM+ + R D Sbjct: 20 PMGPSGPRGLPGPPGAPGDPIPEELYEMLSDHSIRSFD 57 >AF111169-4|AAD44364.1| 608|Homo sapiens unknown protein. Length = 608 Score = 31.9 bits (69), Expect = 2.3 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +1 Query: 304 LIRQHYY--STFIKPPSLALHHVL*DAPPMPRKPSELPNPKGAKGVPPP 444 +++++YY + PP LAL + D+ P KP LP P+ G PP Sbjct: 64 MLQENYYLQEMVLCPPVLALTIIPGDSQPTGDKPEALPGPRLPPGSCPP 112 >Y15918-1|CAA75878.1| 173|Homo sapiens COL1A1 and PDGFB fusion transcript protein. Length = 173 Score = 30.7 bits (66), Expect = 5.2 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 382 PMPRKPSELPNPKGAKGVPPPQRIWEMVMNELDRRED 492 P R + LP PKG +G P P+ ++EM+ + R D Sbjct: 132 PGERGAAGLPGPKGDRGDPIPEELYEMLSDHSIRSFD 168 >AF211950-1|AAG10399.1| 397|Homo sapiens lim-homeobox transcription factor LHX3 protein. Length = 397 Score = 24.6 bits (51), Expect(2) = 6.9 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 415 PKGAKGVPPPQRIWEMVMNELDRREDPSNDEFYPDVP 525 P GA G PPP R+ D S YPD P Sbjct: 348 PSGAPGGPPPMRVLAGTGPSSDLSTGSSGG--YPDFP 382 Score = 24.2 bits (50), Expect(2) = 6.9 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +1 Query: 379 PPMPRKPSELPNPK 420 PP+PR+P+E P P+ Sbjct: 318 PPIPRRPAEPPWPQ 331 >BC008965-1|AAH08965.2| 837|Homo sapiens BAZ2A protein protein. Length = 837 Score = 30.3 bits (65), Expect = 6.9 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 382 PMPRKPSELPNPKGAKGVPPPQRIW 456 P P +P E P P A+ P PQ +W Sbjct: 235 PAPSQPPEEPEPDEAESSPDPQALW 259 >AB002312-1|BAA20773.2| 1899|Homo sapiens KIAA0314 protein protein. Length = 1899 Score = 30.3 bits (65), Expect = 6.9 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 382 PMPRKPSELPNPKGAKGVPPPQRIW 456 P P +P E P P A+ P PQ +W Sbjct: 1293 PAPSQPPEEPEPDEAESSPDPQALW 1317 >BC146791-1|AAI46792.1| 1858|Homo sapiens myosin XVI protein. Length = 1858 Score = 29.9 bits (64), Expect = 9.1 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +1 Query: 355 LHHVL*DAPPMP--RKPSELPNPKGAKGVPPPQRIWE 459 LHH PP P +KPS L P+GA P +W+ Sbjct: 1819 LHHAEPRVPPPPPCKKPSLLKKPEGASCNRLPSELWD 1855 >AL390918-1|CAI15821.1| 1858|Homo sapiens protein ( Human DNA sequence from clone RP11-569E4 on chromosome 13 Contains part of a novel gene (KIAA0865), possible ortholog of rat myosin ). Length = 1858 Score = 29.9 bits (64), Expect = 9.1 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +1 Query: 355 LHHVL*DAPPMP--RKPSELPNPKGAKGVPPPQRIWE 459 LHH PP P +KPS L P+GA P +W+ Sbjct: 1819 LHHAEPRVPPPPPCKKPSLLKKPEGASCNRLPSELWD 1855 >AL353143-1|CAH73221.1| 1858|Homo sapiens protein ( Human DNA sequence from clone RP11-383F12 on chromosome 13 Contains part of a novel gene (including KIAA0865), possible ortholog of rat asin A2 ). Length = 1858 Score = 29.9 bits (64), Expect = 9.1 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +1 Query: 355 LHHVL*DAPPMP--RKPSELPNPKGAKGVPPPQRIWE 459 LHH PP P +KPS L P+GA P +W+ Sbjct: 1819 LHHAEPRVPPPPPCKKPSLLKKPEGASCNRLPSELWD 1855 >AL161431-1|CAI15548.1| 1858|Homo sapiens protein ( Human DNA sequence from clone RP11-54H7 on chromosome 13 Contains the 3' end a novel gene (including KIAA0865) possible ortholog of ). Length = 1858 Score = 29.9 bits (64), Expect = 9.1 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +1 Query: 355 LHHVL*DAPPMP--RKPSELPNPKGAKGVPPPQRIWE 459 LHH PP P +KPS L P+GA P +W+ Sbjct: 1819 LHHAEPRVPPPPPCKKPSLLKKPEGASCNRLPSELWD 1855 >AL157771-1|CAI16366.1| 1858|Homo sapiens protein ( Human DNA sequence from clone RP11-67J18 on chromosome 13 Contains the 5' end of a novel gene (including KIAA0865), possible ortholog ). Length = 1858 Score = 29.9 bits (64), Expect = 9.1 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +1 Query: 355 LHHVL*DAPPMP--RKPSELPNPKGAKGVPPPQRIWE 459 LHH PP P +KPS L P+GA P +W+ Sbjct: 1819 LHHAEPRVPPPPPCKKPSLLKKPEGASCNRLPSELWD 1855 >AL136132-1|CAH70519.1| 1858|Homo sapiens protein ( Human DNA sequence from clone RP11-141M24 on chromosome 13q33.1-34 Contains part of a novel gene, possible ortholog of rat myosin heavy ). Length = 1858 Score = 29.9 bits (64), Expect = 9.1 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +1 Query: 355 LHHVL*DAPPMP--RKPSELPNPKGAKGVPPPQRIWE 459 LHH PP P +KPS L P+GA P +W+ Sbjct: 1819 LHHAEPRVPPPPPCKKPSLLKKPEGASCNRLPSELWD 1855 >AB020672-1|BAA74888.2| 1900|Homo sapiens KIAA0865 protein protein. Length = 1900 Score = 29.9 bits (64), Expect = 9.1 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +1 Query: 355 LHHVL*DAPPMP--RKPSELPNPKGAKGVPPPQRIWE 459 LHH PP P +KPS L P+GA P +W+ Sbjct: 1861 LHHAEPRVPPPPPCKKPSLLKKPEGASCNRLPSELWD 1897 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,020,393 Number of Sequences: 237096 Number of extensions: 2995857 Number of successful extensions: 10066 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 8104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10024 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8063224416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -