BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30163 (475 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 21 4.4 AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esteras... 21 5.8 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 21.4 bits (43), Expect = 4.4 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +1 Query: 289 FNAVVHNTAPTAAPTHVKAVPALQYYHH 372 F A + + A T+ P H P + Y HH Sbjct: 146 FAASIFHAAATSLPLHYPPPPPV-YTHH 172 >AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 21.0 bits (42), Expect = 5.8 Identities = 10/54 (18%), Positives = 22/54 (40%) Frame = -3 Query: 251 WSHQLRGRSMNPSQHHRRVPLVGTCCRRSDHQLLSSCTRTWGRQSPQLGELRFW 90 W++ + + NPS+ + + + R++ L T+ P + FW Sbjct: 468 WTNFAKNGNPNPSEENPLINVTWKPVTRNEMNFLDIGTKLTTGVDPDSERMAFW 521 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 63,857 Number of Sequences: 336 Number of extensions: 1149 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11036865 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -