BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30163 (475 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1002.15c |pmc5|med6|mediator complex subunit Pmc5 |Schizosac... 28 0.63 SPBC19C7.05 |||cell wall organization protein |Schizosaccharomyc... 25 7.8 >SPAC1002.15c |pmc5|med6|mediator complex subunit Pmc5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 216 Score = 28.3 bits (60), Expect = 0.63 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = +2 Query: 113 EEIAYPKYEYNYSVADDHSGDNKSQQEVRDGDVVKGSYSFHEADGSI 253 E YPK N ++ DHS N+ E ++ + YSF D S+ Sbjct: 153 EGYTYPKLS-NDNLEVDHSNTNEPADENKNQSIENADYSFSPEDFSV 198 >SPBC19C7.05 |||cell wall organization protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 150 Score = 24.6 bits (51), Expect = 7.8 Identities = 12/38 (31%), Positives = 19/38 (50%), Gaps = 6/38 (15%) Frame = +1 Query: 265 YTADDHSGFNAVVHNTAPTAA------PTHVKAVPALQ 360 YTA+ + +N+ +HN P + PT VPA + Sbjct: 82 YTAEPEARYNSTIHNPMPPMSQAYRPPPTEPPTVPAYE 119 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,140,603 Number of Sequences: 5004 Number of extensions: 17834 Number of successful extensions: 30 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 182448900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -