BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30162 (702 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g19810.1 68417.m02905 glycosyl hydrolase family 18 protein si... 53 2e-07 At4g19800.1 68417.m02904 glycosyl hydrolase family 18 protein si... 51 6e-07 At4g19770.1 68417.m02901 glycosyl hydrolase family 18 protein si... 47 1e-05 At4g19720.1 68417.m02896 glycosyl hydrolase family 18 protein si... 46 2e-05 At4g19750.1 68417.m02899 glycosyl hydrolase family 18 protein si... 46 2e-05 At4g19820.1 68417.m02906 glycosyl hydrolase family 18 protein si... 45 4e-05 At4g19760.1 68417.m02900 glycosyl hydrolase family 18 protein si... 42 4e-04 At5g19420.1 68418.m02314 zinc finger protein, putative / regulat... 36 0.026 At5g41510.1 68418.m05042 F-box family protein contains Pfam:PF00... 32 0.42 At5g38060.1 68418.m04586 expressed protein ; expression support... 32 0.42 At2g45470.1 68415.m05655 fasciclin-like arabinogalactan-protein ... 32 0.42 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 31 0.56 At4g37270.1 68417.m05275 cadmium/zinc-transporting ATPase, putat... 31 0.74 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 31 0.74 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 30 1.3 At5g63720.1 68418.m07998 hypothetical protein 29 3.0 At5g04470.1 68418.m00445 expressed protein 29 3.9 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 29 3.9 At4g31430.2 68417.m04465 expressed protein 28 5.2 At4g31430.1 68417.m04464 expressed protein 28 5.2 At2g04620.1 68415.m00470 cation efflux family protein potential ... 28 5.2 At1g79910.1 68414.m09336 expressed protein contains Pfam profile... 28 5.2 At1g67180.1 68414.m07642 zinc finger (C3HC4-type RING finger) fa... 28 5.2 At4g19730.1 68417.m02897 glycosyl hydrolase family 18 protein si... 28 6.9 At4g19100.1 68417.m02818 expressed protein 28 6.9 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 28 6.9 At1g12330.1 68414.m01425 expressed protein 28 6.9 At4g11720.1 68417.m01870 hypothetical protein 27 9.1 At4g10640.1 68417.m01738 calmodulin-binding family protein conta... 27 9.1 At2g41460.1 68415.m05122 apurinic endonuclease-redox protein / D... 27 9.1 At2g01850.1 68415.m00118 xyloglucan:xyloglucosyl transferase / x... 27 9.1 At1g31990.1 68414.m03934 expressed protein 27 9.1 >At4g19810.1 68417.m02905 glycosyl hydrolase family 18 protein similar to chitinase/lysozyme GI:467689 from [Nicotiana tabacum] Length = 379 Score = 52.8 bits (121), Expect = 2e-07 Identities = 19/45 (42%), Positives = 29/45 (64%) Frame = +3 Query: 72 YAYKGTQWVGYEDPRSVEIKMNWIKEKGYLGAMTWAIDMDDFKGL 206 Y Y GT W+GY+D +S+ K+ + K++G LG +W + DD GL Sbjct: 314 YCYAGTNWIGYDDNQSIVTKVRYAKQRGLLGYFSWHVGADDNSGL 358 >At4g19800.1 68417.m02904 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 398 Score = 51.2 bits (117), Expect = 6e-07 Identities = 26/81 (32%), Positives = 41/81 (50%) Frame = +3 Query: 30 SGWTKKWDEFGKCPYAYKGTQWVGYEDPRSVEIKMNWIKEKGYLGAMTWAIDMDDFKGLC 209 +G TK D+ Y Y GT W+GY+ +S+ K+ + K+KG LG +W + DD L Sbjct: 278 NGATKVHDDMMVGDYCYAGTTWIGYDSEKSIVTKVIYAKQKGLLGYFSWHVGGDDNSELS 337 Query: 210 GEENPLIKLLHKHMSLTQSRL 272 + +L MS S++ Sbjct: 338 SAGSTPYHILILCMSWKYSKI 358 >At4g19770.1 68417.m02901 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 261 Score = 46.8 bits (106), Expect = 1e-05 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +3 Query: 72 YAYKGTQWVGYEDPRSVEIKMNWIKEKGYLGAMTWAIDMDD 194 Y Y GT W+GY+ S+ K+ + K+KG LG +W + DD Sbjct: 205 YCYAGTTWIGYDSEESIVTKVIYAKQKGLLGYFSWQVGGDD 245 >At4g19720.1 68417.m02896 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 363 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/45 (42%), Positives = 28/45 (62%) Frame = +3 Query: 72 YAYKGTQWVGYEDPRSVEIKMNWIKEKGYLGAMTWAIDMDDFKGL 206 Y + GT +GY+D +SV K+ + K+KG LG +W + DD GL Sbjct: 298 YCFAGTSLIGYDDHQSVVAKVKYAKQKGLLGYFSWHVGADDNFGL 342 >At4g19750.1 68417.m02899 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 362 Score = 46.0 bits (104), Expect = 2e-05 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +3 Query: 72 YAYKGTQWVGYEDPRSVEIKMNWIKEKGYLGAMTWAIDMDDFKGL 206 Y Y GT W+GY+D +S+ K+ + K KG LG +W + D GL Sbjct: 303 YCYVGTTWIGYDDNQSIVSKVRYAKLKGLLGYFSWHVGADYNCGL 347 >At4g19820.1 68417.m02906 glycosyl hydrolase family 18 protein similar to chitinase/lysozyme GI:467689 from [Nicotiana tabacum] Length = 366 Score = 45.2 bits (102), Expect = 4e-05 Identities = 16/41 (39%), Positives = 26/41 (63%) Frame = +3 Query: 72 YAYKGTQWVGYEDPRSVEIKMNWIKEKGYLGAMTWAIDMDD 194 Y Y W+GY+D +S+ +K+ + K++G LG +W I DD Sbjct: 312 YCYAKKTWIGYDDNQSIVMKVKYAKQRGLLGYFSWHIGADD 352 >At4g19760.1 68417.m02900 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:505267 from [Nicotiana tabacum] Length = 365 Score = 41.9 bits (94), Expect = 4e-04 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = +3 Query: 72 YAYKGTQWVGYEDPRSVEIKMNWIKEKGYLGAMTWAIDMDDFKGL 206 Y Y G W+GY+D +S+ K+ + K G LG +W + D GL Sbjct: 313 YCYVGNTWIGYDDNQSIVYKVKYAKFTGLLGYFSWHVGADYNCGL 357 >At5g19420.1 68418.m02314 zinc finger protein, putative / regulator of chromosome condensation (RCC1) family protein similar to zinc finger protein [Arabidopsis thaliana] gi|15811367|gb|AAL08940 Length = 1124 Score = 35.9 bits (79), Expect = 0.026 Identities = 26/81 (32%), Positives = 35/81 (43%) Frame = -2 Query: 671 KFHVERLSPG*HENWNSRRPFTHRQYWLHSFLSGT*AVPSEYTHPHCRLRFPWGVPRTSG 492 K+ E S G NS R +T R LHS S + E ++ H RL P+ P +G Sbjct: 155 KWRTESRSDGTPSEANSPRTYTRRSSPLHSPFSSNESFQKEGSN-HLRLHSPYESPPKNG 213 Query: 491 LTLMSKSSSVCMVKPLLFFSP 429 + S+ V P FF P Sbjct: 214 VDKAFSDMSLYAVPPKGFFPP 234 >At5g41510.1 68418.m05042 F-box family protein contains Pfam:PF00646 F-box domain Length = 400 Score = 31.9 bits (69), Expect = 0.42 Identities = 19/64 (29%), Positives = 29/64 (45%) Frame = +1 Query: 403 REANYYHKTGEKNKRGFTMHTEEDFDINVRPEVRGTPHGKRSRQCGCVYSEGTAYVPDKK 582 R +Y++K E+ F + DFD + + TPH C CV +G Y P K+ Sbjct: 164 RFLDYFYKAPEEE---FFWYEIYDFDSGLWTTLNVTPHWGIYSTCPCVSLKGNTYWPAKE 220 Query: 583 ECSQ 594 +Q Sbjct: 221 RSTQ 224 >At5g38060.1 68418.m04586 expressed protein ; expression supported by MPSS Length = 134 Score = 31.9 bits (69), Expect = 0.42 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = +1 Query: 517 GKRSRQCGCVYSEGTAYVPDKKECSQYWRCVNGRREFQFSC 639 G+ R+ VY+ GT P+ + QYW C F C Sbjct: 84 GETKRKFESVYTGGTMDTPNSGKVLQYWHCCGSEDPFDSGC 124 >At2g45470.1 68415.m05655 fasciclin-like arabinogalactan-protein (FLA8) Length = 420 Score = 31.9 bits (69), Expect = 0.42 Identities = 18/42 (42%), Positives = 22/42 (52%) Frame = +2 Query: 215 GKSLDQASA*AYEPYTVPPARTGHATPTPEWARPPSTPSDPS 340 GKS + A A EP T P A P+P A PP+ P+D S Sbjct: 333 GKSKSPSPAPAPEPVTAPTPSPADA-PSPTAASPPAPPTDES 373 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 31.5 bits (68), Expect = 0.56 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +2 Query: 254 PYTVPPARTGHATPTPEWARPPSTPSDPSEGDP 352 P PP + +TP P PPSTP P+ P Sbjct: 115 PIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPP 147 >At4g37270.1 68417.m05275 cadmium/zinc-transporting ATPase, putative (HMA1) contains InterPro accession IPR001757: ATPase, E1-E2 type; identical to Potential cadmium/zinc-transporting ATPase HMA1 (EC 3.6.3.3) (EC 3.6.3.5) (Swiss-Prot:Q9M3H5) [Arabidopsis thaliana]; identical to cDNA putative transcription factor (MYB73) mRNA, partial cds GI:3941503 Length = 819 Score = 31.1 bits (67), Expect = 0.74 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 352 DSYHNHHHRETDDNKNHREANYYH 423 D +H+HHH + D+ NH ++ H Sbjct: 66 DHHHDHHHDDEQDHHNHHHHHHQH 89 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 31.1 bits (67), Expect = 0.74 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +2 Query: 248 YEPYTVPPARTGHATPTPEWARPPSTPSDPSEGDP 352 Y P +PP + T TP + PP TPS E P Sbjct: 667 YSPPLLPPKMSSPPTQTPVNSPPPRTPSQTVEAPP 701 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +2 Query: 254 PYTVPPARTGHATPTPEWARPPSTPSDPSEGDP 352 P PP + ++ P PE PP P+D E P Sbjct: 106 PIDSPPPESTNSPPPPEVFEPPPPPADEDESPP 138 >At5g63720.1 68418.m07998 hypothetical protein Length = 492 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 4/33 (12%) Frame = +1 Query: 358 YHNHHHRETDDNK----NHREANYYHKTGEKNK 444 +H+HHH D K N ++ ++HK EK+K Sbjct: 373 HHHHHHHHHDKEKPSAWNKLQSKFHHKHQEKSK 405 >At5g04470.1 68418.m00445 expressed protein Length = 127 Score = 28.7 bits (61), Expect = 3.9 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 257 YTVPPARTGHATPTPEWARPPSTPS 331 + +PP P P+ RPPSTPS Sbjct: 41 HKIPPTTATTPPPPPQKPRPPSTPS 65 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +2 Query: 248 YEPYTVPPARTGHATPTPEWARPPSTPSDPSEGDP 352 Y P PP++ A P P + PP P P P Sbjct: 8 YPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQP 42 >At4g31430.2 68417.m04465 expressed protein Length = 574 Score = 28.3 bits (60), Expect = 5.2 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = -2 Query: 557 PSEYTHPHCRLRFPWGVPRTSGLTLMSKSSSVCMVKPL 444 P + + R R PWG P + L S SS+ PL Sbjct: 213 PVDVAKSYMRARLPWGSPAANNLDFRSPSSARVQGTPL 250 >At4g31430.1 68417.m04464 expressed protein Length = 485 Score = 28.3 bits (60), Expect = 5.2 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = -2 Query: 557 PSEYTHPHCRLRFPWGVPRTSGLTLMSKSSSVCMVKPL 444 P + + R R PWG P + L S SS+ PL Sbjct: 213 PVDVAKSYMRARLPWGSPAANNLDFRSPSSARVQGTPL 250 >At2g04620.1 68415.m00470 cation efflux family protein potential member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, see PMID:11500563 Length = 798 Score = 28.3 bits (60), Expect = 5.2 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +1 Query: 361 HNHHHRETDDNKNHREANYYH 423 HNH H + NH E N+ H Sbjct: 613 HNHDHEHQSHSHNHEECNHNH 633 Score = 27.5 bits (58), Expect = 9.1 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = +1 Query: 361 HNHHHRETDDNKNHREANYYHKTGEKNKRGFTMHTEEDFDINVRPEVRGT 510 H+H+H E + N +H + K+ +K R H E ++V + G+ Sbjct: 622 HSHNHEECNHNHDHHSDHQPEKSEKKEHRHID-HNMEGIFLHVLADTMGS 670 >At1g79910.1 68414.m09336 expressed protein contains Pfam profile: PF03398 eukaryotic protein of unknown function, DUF292 Length = 381 Score = 28.3 bits (60), Expect = 5.2 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +1 Query: 358 YHNHHHRETDDNKNHREANYYHKTGEKNKRGFTMHTEED 474 +H+H H ET++ K + + KT EK + + H ED Sbjct: 185 HHHHVHTETEEPKTEKTNSEPEKTMEK-RSSLSFHGRED 222 >At1g67180.1 68414.m07642 zinc finger (C3HC4-type RING finger) family protein / BRCT domain-containing protein contains Pfam domains PF00533: BRCA1 C Terminus (BRCT) domain and PF00097: Zinc finger, C3HC4 type (RING finger) Length = 453 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 364 NHHHRETDDNKNHREANYYHKTGEKNKRGFTMHTEE 471 N+HH +D+N+N E + + ++N RGF E Sbjct: 200 NNHHDNSDENQN--ETQDHREPADENVRGFVFEQGE 233 >At4g19730.1 68417.m02897 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:505267 from [Nicotiana tabacum] Length = 332 Score = 27.9 bits (59), Expect = 6.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 72 YAYKGTQWVGYEDPRSVEIKM 134 Y + W+GYED +SVE K+ Sbjct: 312 YCFAKKIWIGYEDTQSVEAKV 332 >At4g19100.1 68417.m02818 expressed protein Length = 214 Score = 27.9 bits (59), Expect = 6.9 Identities = 24/75 (32%), Positives = 33/75 (44%), Gaps = 4/75 (5%) Frame = +1 Query: 196 LRDYAARKIP*SSFCISI*ALHSPACAHWTRNSYSGMG---ASTFNSIRPI*G-*SDSYH 363 LRD ++P S CI+ + A H T NS G G T S +P G SD Sbjct: 34 LRDKTKSQVPKSITCINRLEISRIAPLHATMNSPKGFGPPPKKTKKSKKPKPGNQSDEDD 93 Query: 364 NHHHRETDDNKNHRE 408 + + DD ++ RE Sbjct: 94 DDEDEDDDDEEDERE 108 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 27.9 bits (59), Expect = 6.9 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +2 Query: 227 DQASA*AYEPYTVPPARTGHATPTPEWARPPSTPSDPSEGDP 352 + +SA P +PP R+ A P P A PP P P P Sbjct: 246 ESSSAAGLPPLKLPPGRS--APPPPPAAAPPPQPPPPPPPKP 285 >At1g12330.1 68414.m01425 expressed protein Length = 505 Score = 27.9 bits (59), Expect = 6.9 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = +1 Query: 343 G*SDSYHNH-HHRETDDNKNHREA-NYYHKTGEKNKRGFTMHTEEDFD 480 G S + NH HHR T+ N NH+ H G+ R H + D D Sbjct: 49 GGSSATPNHQHHRRTNSNNNHQHTLTPLHHNGKPQTR--KRHDDNDED 94 >At4g11720.1 68417.m01870 hypothetical protein Length = 658 Score = 27.5 bits (58), Expect = 9.1 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 Query: 361 HNHHHRETDDNKNHREANYYHK 426 H+HHH+ + +HR + HK Sbjct: 571 HHHHHKHRHHHNHHRRTHQRHK 592 Score = 27.5 bits (58), Expect = 9.1 Identities = 11/35 (31%), Positives = 19/35 (54%), Gaps = 7/35 (20%) Frame = +1 Query: 361 HNHHHRETDD-------NKNHREANYYHKTGEKNK 444 H HHH + DD ++H +++YYH+ +K Sbjct: 591 HKHHHGQDDDVLQKMMLERDHSDSHYYHQLHRVHK 625 >At4g10640.1 68417.m01738 calmodulin-binding family protein contains IQ calmodulin-binding motif, Pfam:PF00612 Length = 423 Score = 27.5 bits (58), Expect = 9.1 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +1 Query: 367 HHHRETDDNKNHREANYYHKTGEKNKRGFTMHT 465 HHH+ETD + ++ + KT + HT Sbjct: 29 HHHKETDIKRKEKKGWIFRKTKLETTNSVLQHT 61 >At2g41460.1 68415.m05122 apurinic endonuclease-redox protein / DNA-(apurinic or apyrimidinic site) lyase identical to apurinic endonuclease-redox protein SP: P45951 from [Arabidopsis thaliana] Length = 536 Score = 27.5 bits (58), Expect = 9.1 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +1 Query: 385 DDNKNHREANYYHKTGEKNKRGFTMHTEEDFDINV 489 D N H E + ++ G K GFT+ + F N+ Sbjct: 429 DLNCAHEEIDIFNPAGNKRSAGFTIEERQSFGANL 463 >At2g01850.1 68415.m00118 xyloglucan:xyloglucosyl transferase / xyloglucan endotransglycosylase / endo-xyloglucan transferase (EXGT-A3) identical to endoxyloglucan transferase [Arabidopsis thaliana] GI:5533313 Length = 333 Score = 27.5 bits (58), Expect = 9.1 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 611 FTHRQYWLHSFLSGT*AVPSEYT 543 F Y+LH F S + +PS+YT Sbjct: 65 FVSNDYYLHGFFSASIKLPSDYT 87 >At1g31990.1 68414.m03934 expressed protein Length = 325 Score = 27.5 bits (58), Expect = 9.1 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +1 Query: 505 GTPHGKRSRQCGCVYSEGTAYVPDKKEC-SQYWRCVNGRR 621 G HG R R+ + + +A KK+ S WRC NG R Sbjct: 232 GCLHGTRFRRWYSPFQKLSALAITKKDVISSSWRCFNGMR 271 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,939,915 Number of Sequences: 28952 Number of extensions: 355401 Number of successful extensions: 1522 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 1228 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1490 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -