BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30161 (676 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pomb... 29 0.61 SPAPB1A10.11c |||glutamyl-tRNA synthetase, mitochondrial|Schizos... 25 10.0 >SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pombe|chr 2|||Manual Length = 2386 Score = 29.1 bits (62), Expect = 0.61 Identities = 18/56 (32%), Positives = 29/56 (51%) Frame = -2 Query: 210 ISPDTKIILRRRLKNISPPGMFKNIKDVNSTNTSDNQLIKLVSRLAEADRETATSS 43 +S + I+LRRRL ++P G FK+ + ST+ + + + AE E A S Sbjct: 1616 VSDNLDIVLRRRLSQVAPYGKFKH--QILSTHLVGYEKFENTKKTAEIYLEIARIS 1669 >SPAPB1A10.11c |||glutamyl-tRNA synthetase, mitochondrial|Schizosaccharomyces pombe|chr 1|||Manual Length = 526 Score = 25.0 bits (52), Expect = 10.0 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 331 RTLVSKYSF*YIKRCKSARYIR 266 R +VSK SF +KRC S +R Sbjct: 14 RYIVSKISFYSLKRCNSTAVVR 35 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,004,518 Number of Sequences: 5004 Number of extensions: 66370 Number of successful extensions: 113 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 309878492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -