BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30161 (676 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC036926-1|AAH36926.1| 193|Homo sapiens TRBV21-1 protein protein. 31 4.9 BC044233-1|AAH44233.1| 692|Homo sapiens leucine rich repeat con... 30 8.6 AY358322-1|AAQ88688.1| 692|Homo sapiens ELLP3030 protein. 30 8.6 >BC036926-1|AAH36926.1| 193|Homo sapiens TRBV21-1 protein protein. Length = 193 Score = 30.7 bits (66), Expect = 4.9 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = -2 Query: 297 LNGVRVHVTLDMCTRYLNTWLETSLRSLQISPDTKIILRRRLKNISPP 154 ++GVR H T+ +C + L + P T++++ LKN+ PP Sbjct: 13 VHGVRGHSTVFLCQQQLGHHELQEQETQYFGPGTRLLVLEDLKNVFPP 60 >BC044233-1|AAH44233.1| 692|Homo sapiens leucine rich repeat containing 33 protein. Length = 692 Score = 29.9 bits (64), Expect = 8.6 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = -2 Query: 159 PPGMFKNIKDVNSTNTSDNQLIKLVSRLAEADRETATSSIPYHTM 25 PPG+F N +++ + + S NQ I L A +DR S + + M Sbjct: 418 PPGLFANARNITTLDMSHNQ-ISLCPLPAASDRVGPPSCVDFRNM 461 >AY358322-1|AAQ88688.1| 692|Homo sapiens ELLP3030 protein. Length = 692 Score = 29.9 bits (64), Expect = 8.6 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = -2 Query: 159 PPGMFKNIKDVNSTNTSDNQLIKLVSRLAEADRETATSSIPYHTM 25 PPG+F N +++ + + S NQ I L A +DR S + + M Sbjct: 418 PPGLFANARNITTLDMSHNQ-ISLCPLPAASDRVGPPSCVDFRNM 461 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,452,502 Number of Sequences: 237096 Number of extensions: 2212469 Number of successful extensions: 3775 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3506 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3775 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7615267504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -