BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30161 (676 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isome... 23 2.7 AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 23 2.7 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 22 6.1 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 8.1 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 8.1 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 8.1 >EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isomerase protein. Length = 247 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 318 DTNVRCISLIPSIYLYY 368 D+NV + +PSIYL Y Sbjct: 33 DSNVEVVVGVPSIYLTY 49 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = +2 Query: 194 FVSGLIWSDRNDVSSQVFKYLVHISNVTCT 283 F G W ++ V KYL+H+ + T Sbjct: 88 FYLGKEWKKNLNLRDSVTKYLIHLKEIEDT 117 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.8 bits (44), Expect = 6.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 518 PRRLKVVRRGPEIKIGNFPNAG 583 P R K+++ G IK G F +G Sbjct: 55 PNRQKILKDGFPIKCGTFLGSG 76 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 8.1 Identities = 5/13 (38%), Positives = 9/13 (69%) Frame = -1 Query: 469 ISTRYITYSHPLW 431 + +Y+TY +P W Sbjct: 515 VPVKYLTYEYPWW 527 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 8.1 Identities = 5/13 (38%), Positives = 9/13 (69%) Frame = -1 Query: 469 ISTRYITYSHPLW 431 + +Y+TY +P W Sbjct: 568 VPVKYLTYEYPWW 580 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.4 bits (43), Expect = 8.1 Identities = 10/40 (25%), Positives = 19/40 (47%) Frame = +2 Query: 461 STNGILICKSHIMRDVNVIPRRLKVVRRGPEIKIGNFPNA 580 +TN C++ ++P L + + P IK+ N P + Sbjct: 18 ATNSPHTCRTKNGDYTKIMPDILTAIGQTPLIKLNNIPKS 57 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,928 Number of Sequences: 438 Number of extensions: 4769 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -