BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30159 (729 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 25 0.47 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 22 5.8 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 22 5.8 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 25.4 bits (53), Expect = 0.47 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -2 Query: 692 HPGPEYLVLGCTRPHPSVAQRSGEEPNK*RSPGDCLGL 579 H G + + LGC PS+ Q ++ RS GD + L Sbjct: 361 HMGGDEVHLGCWNSTPSIVQWMQDQKGWGRSEGDFIKL 398 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 21.8 bits (44), Expect = 5.8 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 350 TKRPFLFLRSFY 315 T +PFLF SFY Sbjct: 31 TDKPFLFFGSFY 42 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.8 bits (44), Expect = 5.8 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -3 Query: 415 ISRSPADCF*CVVILCPWSKMELRDRSCSYG 323 I R P+DC + SK+ R C++G Sbjct: 448 IVRDPSDCSVYYTCVSDGSKLVSIQRKCNHG 478 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,838 Number of Sequences: 336 Number of extensions: 4276 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -