BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30158 (742 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0353 - 3107628-3107774,3108177-3108213,3108248-3109164,310... 28 9.0 03_01_0642 - 4702726-4703052,4703127-4703193,4703280-4703360,470... 28 9.0 >08_01_0353 - 3107628-3107774,3108177-3108213,3108248-3109164, 3109210-3110952 Length = 947 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/33 (36%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +3 Query: 288 EDVITIVGSPSIEMQ-EKMAEEEKRRIEDQRAL 383 E+V+ +V E + +KM EEEK+R++++ L Sbjct: 4 EEVVVVVDEEESERRRQKMIEEEKKRLDEEMEL 36 >03_01_0642 - 4702726-4703052,4703127-4703193,4703280-4703360, 4703582-4703718,4703936-4704143,4704664-4704891, 4705310-4705450,4705538-4705794 Length = 481 Score = 27.9 bits (59), Expect = 9.0 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -1 Query: 178 STESLRCSGMRWPDAA*PQGWPRSPGVVSAV-VSPNGPCRWARR 50 S E L+C+ AA P G PR+ + AV + G RW RR Sbjct: 5 SPEELKCAANGGCAAASPGGTPRAGHYLPAVPAAVEGELRWLRR 48 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,912,382 Number of Sequences: 37544 Number of extensions: 435628 Number of successful extensions: 1427 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1382 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1427 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1957111448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -